KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0352Help
Entry
FTW_0352          CDS       T00495                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
ftw00900  Terpenoid backbone biosynthesis
ftw01100  Metabolic pathways
ftw01110  Biosynthesis of secondary metabolites
ftw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ftw00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FTW_0352 (dxr)
Enzymes [BR:ftw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     FTW_0352 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C NmrA Semialdhyde_dh DapB_N Sacchrp_dh_NADP RsbU_N
Motif
Other DBs
NCBI-ProteinID: ABO46293
UniProt: A4IWJ1
Position
347099..348256
Genome map
AA seq 385 aa AA seqDB search
MFKKTKITILGATGSIGDSTLAVIRETNDFEVFALTAFSNVEKLAELCQEFKPKFAVVPD
LSKKQKLQSLVTDVEVLVGESGLEKVSSLAEIDIVMSAIVGIAGLKPTFAAAKAGKKILL
ANKESLVTAGHLLIDEVVKNNAQLIPVDSEHNAIFQCIDNHDKKCLPEIDKIILTASGGP
FRDKQLHELTDVTPEQACNHPNWQMGRKISVDSSTMVNKALEVIEAYWLFSVSADKIGVL
IHPQSVTHSMVRYVDGSYIAQLGVPDMKTPIANAMYYPKRGSVNVESLDFTKYQLTFREA
CFERFEALKIVFNNLQNKNYAANIVFNAANEELVAAFLNKKIKYLEIIEVNKKVTKELNF
ENPKNIEEVFEIDRKTREYVDSVLG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaactaagattactatattaggagctacaggatctataggtgatagcact
ttagctgttattagagagactaatgattttgaagtttttgcattaactgcatttagtaat
gttgaaaagctggcggagctatgtcaagagtttaagcctaaatttgctgtagttccagac
ttgtcaaaaaaacaaaagttacaatcattagttactgatgttgaggttttggttggtgaa
agtgggcttgaaaaagtatctagcttagctgaaattgatattgtcatgtctgctatagtt
ggtatagcagggttaaaaccaacctttgcagcagctaaagctggtaagaaaattttgctt
gctaataaagaatctttggtaacagcaggacacttgctgatagatgaggttgtaaagaat
aatgctcaacttattcctgtggatagtgaacataatgctatatttcagtgtattgataat
catgataagaagtgtttgccagagattgataagataattttaacagcatctggaggtcct
tttagagacaaacaactacatgagttaacggatgtaacacccgagcaagcatgcaatcat
cctaattggcaaatgggcagaaaaatatcggttgattcatcaactatggtaaataaagcg
ttagaagttatcgaagcgtattggcttttttctgtttcagctgataaaataggcgttctg
attcatccgcagagtgtaactcattctatggtcagatatgttgatggtagctatatagcg
cagttaggtgtgcctgatatgaaaacacctatagccaacgcaatgtactatccaaagaga
ggatcagttaacgttgagagcttagattttacaaaatatcagctaaccttcagagaagct
tgttttgaaagatttgaagctttgaaaatagtttttaataatttacaaaataaaaattat
gctgctaacatagtttttaatgctgctaatgaggagcttgtggctgcatttttaaacaaa
aaaattaaatatttagagataatagaagtaaacaaaaaagtaacaaaagagttaaatttt
gagaatccaaaaaatatagaagaagtttttgaaatagatagaaaaactcgtgaatatgtg
gattctgttttggggtaa

DBGET integrated database retrieval system