KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2699Help
Entry
Glaag_2699        CDS       T01483                                 

Definition
aldose-1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Glaag_2699
Enzymes [BR:gag01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Glaag_2699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3165170..3166009
Genome map
AA seq 279 aa AA seqDB search
MHLCKTASLLPQDDIEMLIIDNDHAHATISLFGGHVLSFIPKHDNVQRLWLSKEAMLDGQ
HPIRGGIPICWPWFGAHASESGLASHGYVRTQNWHVVDCADEPEQTVVRLKPRTTQGQGF
EGETQLSLVLFIGRELRIQLVTENTGSEPLSYTSALHTYFNIDDINHCELTGLDGDYLDK
LQDYQRISTPTPYTFNEETDRVHLVTPESLTIVSGNIKTHIQSSGHDSIVVWNPWADKSK
SMQDMEDQGYKNMLCVETAVTQGQQVLPGQSHTLEQVIR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcacctatgtaaaaccgcatctttacttccacaagatgatatcgaaatgctgatcatc
gataacgatcatgcccatgcgactatctctttattcggcggccatgttctcagcttcatt
cctaaacacgacaatgtacaacgactttggttaagcaaagaagccatgctcgacggccag
cacccaataaggggcgggatcccaatttgttggccttggttcggcgctcacgcatctgaa
agtggtttagcttctcatggttacgtgcgtacccaaaactggcatgtggtagattgcgcg
gatgaacctgagcaaacggtcgttcgactcaagccgaggacaacacaaggacagggtttt
gaaggtgaaacacaattgagcttagtcttgttcataggacgagaattgcgcattcaattg
gtcactgaaaacacgggcagcgagccactcagttataccagtgcattacacacttatttc
aacattgatgatattaaccattgtgaattaaccggtttagacggtgattatttagataaa
ctgcaagattatcagcgtatcagcacccctaccccctacacgtttaatgaagaaacggac
cgagtacacttagttacacctgagtcactaacaattgtctcagggaatattaaaacccat
attcagtcaagcggtcacgacagcatagtcgtatggaatccatgggctgataaatcaaaa
agcatgcaggatatggaagaccagggctataaaaatatgttgtgcgttgaaacggctgtt
acgcaaggccaacaagtattgccagggcaatcccatacattagagcaagtcattcgctag

DBGET integrated database retrieval system