KEGG   Geitlerinema sp. PCC 7407: GEI7407_1978Help
Entry
GEI7407_1978      CDS       T02366                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GEI7407_1978
Enzymes [BR:gei01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     GEI7407_1978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2413946..2414728
Genome map
AA seq 260 aa AA seqDB search
MLELYQFEMSHYSEKVRLILDYKGLAYRTVEVTPGLGQFDLYRMSGQRQVPVLKDGTQVI
ADSTAIALYLERQYPDRPILPTDARDRALCLMMESWADEVIGTKGRIAMLAAFSQDPSFR
TSALPSSTPDIIRNLVSAVPGDPLRALDDLTGAKAAREELKQALESLSALLLDRPYLIGD
QPTLADFAVAGLSMYLKFPAGPYLRIPETLKGRGVPGLADSPEYAGFFAWRDRLYDDYRK
PPLSPAEPTNDDAPKRIVID
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggagctttatcaatttgagatgtcgcactactccgagaaggtgcgcctcatcctg
gactacaaagggttggcgtatcggacggtggaggtaactccgggcctcgggcagtttgac
ctgtaccggatgtcgggacagcgccaggtgccggtgctcaaggacggaacccaggtgatc
gcagactctacggcgatcgccctttatctcgagcgccagtatcccgatcgccctatcctg
cccacagatgcccgcgatcgggcgctgtgcctgatgatggagtcctgggccgacgaagtg
atcggcaccaaggggcgcattgccatgctggccgccttcagccaagatcccagcttccgc
acctcggcgctgccgtcgtcgacgccggacatcatccgcaatctggtcagcgcggtgcct
ggcgatccgctgcgggccctcgatgacctcaccggcgccaaggccgcccgggaagagctc
aagcaagccctcgaatccctaagcgcgctgctgctcgatcggccttacctgatcggcgat
cagcccaccctggccgattttgcggtggcgggcctgagcatgtacctgaagtttcccgca
gggccgtatctgcggattcctgaaaccctcaagggtcgaggggtgcccggtctagccgac
agcccagagtatgcgggcttcttcgcgtggcgcgatcgcctctatgacgactaccgcaag
ccgcccctgtcccctgccgagcccaccaacgacgacgctcccaagcgcatcgtgatcgac
tag

DBGET integrated database retrieval system