KEGG   Geitlerinema sp. PCC 7407: GEI7407_2225Help
Entry
GEI7407_2225      CDS       T02366                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    GEI7407_2225
Enzymes [BR:gei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     GEI7407_2225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2745425..2747119
Genome map
AA seq 564 aa AA seqDB search
MRDFSSLSNTPYDLVIIGGGINGAGVARDAALRGLKTLLLEKGDFASGTTSWSTRLVHGG
LRYLEYFEFSLVRESLREREILLNTAPHLVEALKLTIPIYTHSDRPYWKIWAGMILYDVF
SYDKTLPWHQMLPQRNFQQLFRSLDDRDLKGGAQYYDAQVAQAERLCLENLWDAQAAGAT
ILNYACVTELAREGDRLQGLTVRDELTGETFNLELGDRTVVINTSGPWVDQVCGLGTEHH
QAAPIGARQKMGGTKGSHIIVETFPGAPETALYTEARRDQRPIFIVPWLGMYLIGTTDLP
YSGDLDRIKASDDEVDYLLAEANALIPSAQLTRQDVKFTYSGVRPLPNEAGKKPGSITRR
HILVDHASEGVRNLISLVGGKLTTYRSVGEEMVDAVYQKRGETAPPCPTQQRPLPGAILP
KDPLIGQTIQRYRDRVSLASIDYLFSVYGRQAEDVLALVDEAPDLAQPIAEDLPDIRAQI
VYSVRSEMAQTLVDILRRRTLLAVKGSYGRELLPVITDVLAAHCGWSREACDRQQADYHA
YIEANCLPDYAIARKPARAASLSA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgcgagatttttcatctttatcaaatacgccctatgaccttgtcatcattggcggcggc
attaatggtgctggggtcgctcgagatgcggctctccgcggtttaaagacactcttgtta
gaaaaaggagattttgccagcggcaccaccagctggtctactcgattagttcacggcggc
ttgcgctacctcgagtattttgagttttcgctggtgcgagagtctctacgagagcgcgag
atcctgctcaataccgcgcctcacctcgtcgaggccctcaaactcacaatcccgatctat
acccacagcgatcgcccctattggaagatctgggccgggatgattttgtacgatgtcttt
agctatgacaagacgctgccgtggcaccagatgcttccccagcgcaacttccagcagctt
tttcgatctttagacgatcgcgatctcaagggcggagcgcagtactatgacgcccaggtg
gcacaagcagagcgcctgtgccttgagaatctctgggatgcccaagccgcgggagcgacg
atcctcaactatgcctgcgttacggagctggcgcgagagggcgatcgccttcaggggctg
acggtgagagatgaattaacgggagagacatttaatcttgagctgggcgatcgcactgtg
gtgatcaacaccagcggcccctgggtcgaccaggtgtgtggcttggggaccgagcaccat
caggcagcacccatcggcgctcgccaaaagatgggcggcactaagggtagccatatcatc
gtagagacgtttccgggggctcccgagaccgcgctctacaccgaggcacgccgcgaccag
cgccctatttttatcgtgccctggctcggcatgtatctcattggcaccaccgatctgccc
tactccggagacctcgatcgcatcaaggccagcgatgatgaagtcgactatctcctcgcc
gaagccaacgccctgattcccagcgctcagctcactcggcaagacgtgaaattcacctac
tccggagtgcggccgctgcccaatgaagcgggcaaaaagcccggcagtatcactcgccga
catattttggttgatcatgcctctgaaggggtcaggaacctgatctctctggtggggggc
aagctcaccacctatcgcagcgttggcgaagagatggtcgacgcagtctatcaaaagcgg
ggagagacagcgcctccctgccccacgcagcagcggccgctgccgggagcaattttgccc
aaagatcccctgattggccaaaccattcagcgctatcgcgatcgcgtttcgctagcttcc
attgactatctcttttcggtctatggtcggcaggcagaagacgtgctggccctggttgat
gaggctccagatttggcccagccgatcgctgaagacctgccggatatccgggcccagatc
gtctacagcgtccgatcggagatggcccaaactctggtggatattctgcggcggcggacg
ctcctagcagtcaagggcagctacgggcgggagctcttgccagtcatcaccgacgtactc
gctgctcactgcggctggagccgagaagcgtgcgatcgccagcaggctgactaccacgcc
tacattgaggctaactgcttgcccgattatgccattgcccgcaagcctgctcgcgcagcc
tctctctctgcctaa

DBGET integrated database retrieval system