KEGG   Geobacter sp. M21: GM21_2259Help
Entry
GM21_2259         CDS       T00933                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gem  Geobacter sp. M21
Pathway
gem00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gem01100  Metabolic pathways
gem01110  Biosynthesis of secondary metabolites
gem01130  Biosynthesis of antibiotics
gem01230  Biosynthesis of amino acids
Module
gem_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GM21_2259
Enzymes [BR:gem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GM21_2259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACT18308
JGI: GM21_2259
UniProt: C6DYM4
Position
complement(2633577..2634377)
Genome map
AA seq 266 aa AA seqDB search
MTQLPDVLKKIVDYKQGEVAAMKAEMPLNEIMDRLAELEDHPRGFQAALINSLSSGWTPI
IAEVKKGSPSKGLIRPDFDPLRIARTYQENGATCLSVLTDEHFFMGHLSYLAAIREEVSL
PLLRKDFIFDPYQIYQARAAGADAILLIAAMLDLSQLRDFAALAQELSMDVLLEVHDEKE
LETALQTDCSLIGINNRDLRSFVVDIGTSERLAALVPQGRLVVAESGINRREEIVHLMSK
GLHAFLIGESLMREEDFGAKLRELLG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagctccccgatgtgctgaagaaaatagtcgattacaagcagggcgaagtcgcc
gccatgaaggcggaaatgcccttgaacgagatcatggaccggctcgccgaactggaggac
catccccgtgggttccaggcggcgcttatcaactcgctctcctcgggatggacccccatc
atcgcggaggtgaagaaggggtccccgtccaaggggctgattcgccccgacttcgacccg
ctgcggatcgcccggacctaccaggaaaacggggccacctgcctctccgtcctcaccgac
gagcatttcttcatggggcacctgagctacctggccgccatccgcgaagaggtgtcgctc
ccgctcttgcgcaaggacttcatcttcgacccctaccagatctaccaggcacgcgccgcc
ggggccgacgccatcctcctgatcgccgccatgctggatctctcccagttgcgcgacttc
gccgcgctggcccaggagctctccatggacgtgctcctggaggtgcatgacgagaaggaa
ctggagactgccctgcagaccgactgcagcctgatcggcatcaacaaccgcgatctgagg
agtttcgtggtggacatcggcacctcggagcggctggccgcgctggtgccgcagggtcgc
ctggtggtggcggaaagcggcatcaacaggcgcgaggaaatcgtgcacctcatgtcgaag
gggctgcacgcctttttgatcggcgagtcgctgatgcgcgaggaagacttcggcgcgaag
ctgcgcgaactgctgggttaa

DBGET integrated database retrieval system