KEGG   Geobacter sp. M21: GM21_3444Help
Entry
GM21_3444         CDS       T00933                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gem  Geobacter sp. M21
Pathway
gem00500  Starch and sucrose metabolism
gem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GM21_3444
Enzymes [BR:gem01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     GM21_3444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ACT19467
JGI: GM21_3444
UniProt: C6E5E3
Position
3980794..3982287
Genome map
AA seq 497 aa AA seqDB search
MKKRGSGVLCHITSLPSPFGIGDFGAGAYGFADFLCEAKQSYWQILPLNPTNKRYFDSPF
SSLSSCAGNSALVSPQLLAAEGLLTQYEVEDHPPFSEHRVDYEAASRFKRQLFQRAHTRF
QKGGVPEDYARFCRGNSMWLEDHALFTALSNHLGNAPLTEWPQELSNRNSEKVQLLREEL
WDEVEQEKFLQYLFFKQWHLLKNYCNGKGIRIIGDFAMFMNYDAVDIWANPELFKVDARK
KPSVLAGSPPDAFSADGQLFNCAVYDWDGLKRNGFNWWIRRFHYLFRQYDFVRIDHFRGL
ISYWEVPAGERNGLRGSWQQAPTREFFNTMLQHYPLFPVIAEDLGTIGAEVRETMARYAI
PGMKVLLFGFQKEAREKSYLPHLHPCNSVAYTGTHDTDTVTGWYHSAGEEERQELFRYLG
RRVENGVNWELIRLALMSVAHTAVIQMQDVLGTGGESRMNKPGKAEGNWEWRIPPADLGE
VASRLAEMTICYGRAQD
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgcggtagcggtgttctctgtcacatcacttccctcccctccccattcggc
ataggagactttggcgccggtgcctacgggttcgccgatttcctgtgcgaggcgaaacag
agctactggcagatcttgccgctcaaccccaccaacaagagatatttcgactcccccttc
agctccctctcctcctgcgccgggaacagcgccctcgtcagcccgcagttgctggcggcg
gaggggctcttgacacaatacgaggtggaggatcaccctcctttttcggaacaccgggtg
gattacgaagccgcttcgcgtttcaagcggcagcttttccagcgggcgcacacccgcttc
caaaagggaggcgtaccggaggattacgccaggttctgccggggcaactcgatgtggctc
gaggaccatgccctgtttaccgcactcagtaaccaccttggcaatgcccctctgaccgaa
tggccgcaggagctcagcaaccgcaacagcgaaaaggtgcagctgctgcgcgaagaactc
tgggacgaggtcgagcaggagaaattcctgcagtacctcttcttcaagcagtggcacctg
ctgaagaactactgcaacggcaaggggatccggatcatcggcgacttcgccatgttcatg
aactacgatgccgtggacatctgggcgaacccggaactcttcaaggtcgacgcgcgcaaa
aagccgtccgtgctcgccgggagcccccccgatgccttcagcgccgatggacagctcttc
aactgcgctgtctacgactgggacgggctgaagcgtaacggcttcaactggtggatcagg
cgctttcactacctgttcaggcagtacgatttcgtgaggatcgaccatttccgcggcctg
atctcttactgggaggtcccggcaggggagcgaaacgggctcagggggagctggcagcag
gccccgacgcgggaatttttcaataccatgctgcagcactatcccctcttcccggtgatc
gcggaggacctggggaccatcggcgccgaggtcagggagaccatggccaggtacgccatc
ccggggatgaaggtgctcctcttcggattccagaaggaggcgcgagagaagagttacctg
ccgcacctccatccttgcaacagcgtggcctacaccggcacccacgacaccgacaccgtc
accgggtggtaccatagcgccggggaagaggagcggcaggaactcttccgctatctagga
cggcgggttgagaacggagtgaattgggaactgatcaggctggcgctcatgtcggtggcg
cacacggcggtaatccagatgcaggacgtcttggggacgggcggagaatcgaggatgaac
aaacccgggaaagcggaagggaattgggagtggaggatcccgccagccgatcttggagag
gtcgcttcccgtctcgccgagatgacgatctgctacggacgggcgcaggattga

DBGET integrated database retrieval system