KEGG   Geobacter sp. FRC-32: Geob_0290Help
Entry
Geob_0290         CDS       T00846                                 

Definition
DNA glycosylase/AP lyase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
geo  Geobacter sp. FRC-32
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:geo03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
353609..354388
Genome map
AA seq 259 aa AA seqDB search
MPELPDLTVFAENLGKRVTKKMIRSVTCGRNLRLNVSPRELAESLQDQVIEGVERWGKEI
RFLLGNGKILHVHLMLTGGFVITGKPDKVPFPQLVIGFEDDTSLVVTDEKAMAMAALDPE
KAEASPDALAVTVDELKRLISRFPKAKAKAFLIDQKVMRGIGNAYADEILWEARISPLSL
MGKLTPQTIEVLAEKIPAVLQWAIVSIKERNPGITAGEIRDFLQVHNPSRKTSPTGRPII
KEKIAQKTTYYTDEQKLYV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgccggagttgcctgatctgactgtttttgccgaaaacctgggtaagagggtaacgaag
aaaatgatacgatcggtgacgtgcgggagaaatttgcgcctgaatgtttctccccgggaa
cttgcagaatcattgcaggatcaggtgatagaaggtgtggaacgctggggaaaggagatc
cggtttctccttggcaacggcaaaatattacacgtccatctgatgctgaccggcggcttc
gttataaccggcaagccggacaaggttccttttccgcagctggtgatcggcttcgaggac
gatacaagccttgtcgtcaccgatgaaaaagccatggccatggcggcactcgatccggaa
aaggcggaagcttcacctgatgccctggcggtaaccgtcgatgagctgaaacgcctgatt
tccaggtttccgaaggctaaggccaaggcgtttctcatcgaccagaaagtgatgcgcggc
ataggcaacgcctatgctgacgagatcttgtgggaagcccgcatctcacccctgtctttg
atgggaaagctgaccccccagaccattgaagtgcttgcggaaaaaataccggcagtcctg
cagtgggccattgtctccatcaaggagaggaatcccggcatcactgccggtgagatccgg
gatttcctacaggtgcataacccttcccgcaaaacatcacccacgggacgaccgatcatc
aaggagaagattgcccagaagacgacctattataccgatgagcagaaactatatgtatag

DBGET integrated database retrieval system