KEGG   Gramella forsetii: GFO_1902Help
Entry
GFO_1902          CDS       T00448                                 

Definition
M42 family peptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gfo  Gramella forsetii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gfo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1995698..1996792
Genome map
AA seq 364 aa AA seqDB search
MTMKKSEVLDKKSLEFLETYLNNAAPTGYESEGQKLWMEYLKPYVDEFITDTYGTAVGVI
NPEAKYKVVIEGHADEISWYVNYISDEGLIYVVRNGGSDHQIAASKRVNIHTKKGIVKGV
FGWPAIHTRDKEKEQSPKMDNICIDVGCDNKEDVEKLGVHVGCVITYPDEFFVLNGDKFV
CRALDNRIGGFMIAQVARLLKENKKELPFGLYVTNSVQEEIGLRGAEMITHRIQPNVAIV
TDVTHDTTTPMIEKKTNGLNKIGDGPVISYAPAVQNKLRELILDTAENKKIPFQRHASSR
FTGTDTDAFAYSNGGVPSALISLPLRYMHTTVEMVHRDDVENVINLIYESLLNIKEGDSF
SYFD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgaagaaaagtgaagtacttgacaaaaaatcattagagtttctagagacttat
ttaaataatgcagctccaaccggttatgaatctgaaggacagaaattatggatggagtat
ttaaaaccatacgtggatgagtttattactgatacctatggtactgccgtgggagtgata
aatccggaagctaaatataaggtagttatagagggccatgcagatgaaatttcatggtat
gtaaattatataagtgatgaaggcttaatctatgttgtacgaaatggtgggagcgaccat
cagatcgcggcatctaaaagagtaaatatccatactaaaaagggaattgtaaagggagta
tttggctggccagccattcacaccagagataaagaaaaagaacaatccccgaaaatggac
aatatctgtatagatgttggatgtgataataaagaggatgttgaaaaactgggagtacat
gtaggttgcgtgatcacgtatccagatgagttctttgtgttgaacggagataaatttgtt
tgtcgtgctcttgataaccgaattggaggttttatgattgctcaggtagcgagacttcta
aaggagaataagaaagaattacctttcggattatatgtcacaaattctgttcaggaagag
attggattgagaggcgctgaaatgatcactcacaggattcaaccgaatgttgctattgtt
accgatgtgactcacgacactaccactccaatgatcgaaaagaaaactaatggattaaat
aaaattggagacggacccgtaatttcgtatgctcctgcagttcagaataaactgagagaa
cttattctggatactgcagaaaacaaaaagattcctttccaaagacatgcatcttccaga
tttaccgggacagatactgatgcttttgcctacagtaatggcggagttccttcagcattg
atttctttaccattaagatatatgcacactacggtagaaatggttcatcgagatgatgtt
gaaaatgtgattaatcttatctatgaatctcttctgaatattaaagaaggagatagtttt
agttacttcgactag

DBGET integrated database retrieval system