KEGG   Gallus gallus (chicken): 395126Help
Entry
395126            CDS       T01006                                 

Gene name
USP7, UBP
Definition
ubiquitin specific peptidase 7 (herpes virus-associated) (EC:3.4.19.12)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Pathway
FoxO signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    395126 (USP7)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    395126 (USP7)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     395126 (USP7)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   395126 (USP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
14
AA seq 1101 aa AA seqDB search
MNHHQQQQHQKPGEQQLSEPEDMEMEAGDADDPPRITQNPVINGNVAMADGHNNTEEDME
DDTSWRSEATFQFTVERFNRLSESVLSPPCFVRNLPWKIMVMPRLYPDRPHQKSVGFFLQ
CNAESDSTSWSCHAQAVLKIINYKDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPE
KGFIEEDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRK
AVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELC
RVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNI
FESFIDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIK
INDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKF
DDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQPVTDHDIPQQL
VERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNS
TLTEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTI
FLETVDPEMAATGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVM
CERAGFPQETNLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDSSEL
PTAKEYFRDLYSRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFF
KSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCTWLN
SQFREEEITVYPDKHGCVRDLLEECKKVVELSEKGSGKLRLLEIVSYKIIGVHQEDELLE
CLSPATSRTFRIEEIPLAQVDIDKENEMLITVAHFHKEVFGTFGIPFLLRIHQGGHFREV
MKRIQTMLDIQEKEFEKFKFAIVMMGRHTYLNEDEYEVNLKDFEPQPGNMSHPRPWLGLD
HFNKAPKDRYTYLEKAYKIHN
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccatcagcagcagcagcaccagaagcccggggagcagcagctgagcgagccc
gaggacatggagatggaagctggagatgcagatgatcctccaagaattactcaaaaccct
gtcattaatgggaatgtagcaatggctgatggacacaacaacactgaagaagacatggaa
gatgatacaagttggcggtcagaggctacctttcagttcacagtcgaacgcttcaacaga
ttgagtgagtcagttctcagccctccctgctttgtacggaatttgccatggaagatcatg
gtcatgccacgactctacccggacagacctcaccaaaaaagcgtaggattcttcctccag
tgcaatgcagaatctgattccacgtcatggtcttgtcatgcacaagcagttctcaagata
ataaactacaaagatgatgaaaaatcattcagtcgtcgtattagtcacttgttctttcat
aaggaaaatgactggggcttttccaactttatggcctggagtgaagttactgatcctgaa
aagggctttatagaagaggacaaggttacttttgaagtctatgttcaagcagatgctccc
catggagtggcgtgggattcaaagaagcacacaggatatgttggcttaaagaaccaggga
gcaacttgttacatgaacagtttgttacagactttatttttcacaaatcaactacgaaag
gctgtgtacatgatgcccactgaaggagatgattcatccaaaagtgttcctttagcattg
caaagagtgttttatgagctgcaacatagtgacaaaccagttggaactaaaaagctaaca
aagtcttttgggtgggaaactttagacagcttcatgcaacatgatgtccaggagttatgt
cgagtgctgcttgataacgtggaaaataaaatgaaaggcacatgtgtagaaggcactatt
cctaaattgttcagaggaaagatggtgtcttatatccaatgcaaacatgtagactatcga
tctgaacgaatagaagattattatgatatccagctaagtataaagggaaagaaaaatatt
tttgagagcttcattgactatgttgcagtggagcagttggatggtgataacaagtatgat
gcaggagagcatggcttgcaggaggcagagaaaggtgtgaagttcctaacgttgccacca
gtactacatctgcagctcatgagatttatgtatgatcctcagactgatcaaaacatcaag
ataaatgataggtttgagtttcctgaacagttgccactagatgaatttttgcaaaaaaca
gatcctaaagatccagcaaattacattcttcatgcagttctagtacacagtggagataac
catggtggacattatgttgtttacttaaatccaaagggtgatggaaaatggtgtaaattt
gatgatgatgttgtatcaagatgtaccaaggaagaggcgattgaacacaactatggaggc
cacgacgacgacttatctgtacggcactgcactaatgcgtacatgttggtttacatcagg
gaatcgaaattaagtgaagtcttgcagcctgttacggaccatgatattcctcagcaactt
gtggaaaggctacaagaagagaaaagaatagaggctcagaagaggaaggagaggcaggaa
gctcacctctacatgcaagtgcagatagtagcagaggatcagttctgcggccaccaaggc
aatgacatgtatgatgaagaaaaagtgaaatacaccgttttcaaagtattaaaaaactcc
acgttgacagaatttgttcaaaacctctctcaaacaatgggatttccccaggatcagatc
agattatggccaatgcaagctagaagtaatggaacaaaaagacctgcaatgttagataat
gaagcagatggcaataaaacaatgattgagctcagcgacaatgaaaatccatggacaata
tttttggaaacagtagatccagagatggctgctactggagcaacattacccaagtttgat
aaagatcatgatgtaatgttgtttctgaagatgtatgatccgaaaactcggagtttgaat
tattgtggacatatctacacacctatatcctgtaaaatacgtgacttgcttccagttatg
tgtgagagagcaggatttccacaagaaactaaccttatcctctatgaggaagttaaaccc
aatttaacagaaaggattcaagactatgatgtgtctcttgataaagctcttgatgaactc
atggatggtgacatcatagtgtttcagaaggatgacccagaaaacgatagcagtgagctg
ccaacagctaaggaatacttccgagacctctattctcgtgtggatgtcattttctgtgat
aaaaccatccccaacgaccctggttttgttgttactttgtccaataggatgaattacttt
caggttgcaaagacagttgcacaaagacttaatacagatccaatgctattacagtttttc
aagtctcaaggttatagggacggccctggtaatccccttaggcacaattatgaaggtact
ttaagagatcttctgcagttcttcaagcctaggcaacctaaaaagctttactatcaacag
ctcaaaatgaaaataactgattttgaaaacagaagaagttttaaatgcacatggctaaat
agccaatttagggaagaggaaataacagtatatccagataagcatgggtgtgtgcgggac
ctcttagaagaatgtaaaaaagttgtagagctctctgaaaaaggttcagggaaattaagg
ctgctagaaattgtaagttacaaaataattggcgtccatcaggaagatgagctgttagag
tgtttgtcacccgcaacaagtcgaacgtttcgaatagaggaaattcctctggcccaggta
gatatagataaagaaaatgagatgctaatcacagtggcacatttccacaaggaggttttt
gggacatttggaattccgttcttgctgaggatacaccagggcggacacttcagagaggtt
atgaagcggattcagacaatgctggacatacaggaaaaagaatttgaaaagtttaaattt
gcaattgtaatgatgggccgacacacgtatctcaatgaagatgagtatgaagtgaacttg
aaagattttgagccccaaccaggcaacatgtctcatccaaggccgtggctagggcttgac
catttcaataaagccccaaaggatcgctacacttaccttgaaaaagcatataaaatccat
aactga

DBGET integrated database retrieval system