KEGG   Gallus gallus (chicken): 395126Help
Entry
395126            CDS       T01006                                 

Gene name
USP7, UBP
Definition
(RefSeq) ubiquitin specific peptidase 7
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Pathway
FoxO signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    395126 (USP7)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    395126 (USP7)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     395126 (USP7)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   395126 (USP7)
Ubiquitin system [BR:gga04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    395126 (USP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
14
AA seq 1102 aa AA seqDB search
MNHHQQQQHQKPGEQQLSEPEDMEMEAGDADDPPRITQNPVINGNVAMADGHNNTEEDME
DDTSWRSEATFQFTVERFNRLSESVLSPPCFVRNLPWKIMVMPRLYPDRPHQKSVGFFLQ
CNAESDSTSWSCHAQAVLKIINYKDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPE
KGFIEEDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRK
AVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELC
RVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNI
FESFIDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIK
INDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKF
DDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQPVTDHDIPQQL
VERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNS
TLTEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTI
FLETVDPEMAATGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVM
CERAGFPQETNLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSEL
PTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFF
KSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLN
SQFREEEITVYPDKHGCVRDLLEECKKVVELSEKGSGKLRLLEIVSYKIIGVHQEDELLE
CLSPATSRTFRIEEIPLDQVDIDKENEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFREV
MKRIQTMLDIQEKEFEKFKFAIVMMGRHQYLNEDEYEVNLKDFEPQPGNMSHPRPWLGLD
HFNKAPKRSRYTYLEKAIKIHN
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccatcagcagcagcagcaccagaagcccggggagcagcagctgagcgagccc
gaggacatggagatggaagctggagatgcagatgatcctccaagaattactcaaaaccct
gtcattaatgggaatgtagcaatggctgatggacacaacaacactgaagaagacatggaa
gatgatacaagttggcggtcagaggctacctttcagttcacagtcgaacgcttcaacaga
ttgagtgagtcagttctcagccctccctgctttgtacggaatttgccatggaagatcatg
gtcatgccacgactctacccagacagacctcaccaaaaaagcgtaggattcttcctccag
tgcaatgcagaatctgattccacgtcatggtcttgtcatgcacaagcagttctcaagata
ataaactacaaagatgatgaaaaatcattcagtcgtcgtattagtcacttgttctttcat
aaggaaaatgactggggcttttccaactttatggcctggagtgaagttactgatcctgaa
aagggctttatagaagaggacaaggttacttttgaagtctatgttcaagcagatgctccc
catggagtggcgtgggattcaaagaagcacacaggatatgttggcttaaagaaccaggga
gcaacttgttacatgaacagtttgttacagactttatttttcacaaatcaactacgaaag
gctgtgtacatgatgcccactgaaggagatgattcatccaaaagtgttcctttagcattg
caaagagtgttttatgagctgcaacatagtgacaaaccagttggaactaaaaagctaaca
aagtcttttgggtgggaaactttagacagcttcatgcaacatgatgtccaggagttatgt
cgagtgctgcttgataacgtggaaaataaaatgaaaggcacatgtgtagaaggcactatt
cctaaattgttcagaggaaagatggtgtcttatatccaatgcaaacatgtagactatcga
tctgaacgaatagaagattattatgatatccagctaagtataaagggaaagaaaaatatt
tttgagtccttcattgactatgttgcagtggagcagttggatggtgataacaagtatgat
gcaggagagcatggcttgcaggaggcagagaaaggtgtgaagttcctaacgttgccacca
gtactacatctgcagctcatgagatttatgtatgatcctcagactgatcaaaacatcaag
ataaatgataggtttgagtttcctgaacagttgccactagatgaatttttgcaaaaaaca
gatcctaaagatccagcaaattacattcttcatgcagttctagtacacagtggagataac
catggtggacattatgttgtttacttaaatccaaagggtgatggaaaatggtgtaaattt
gatgatgacgttgtatcaagatgtaccaaggaagaggcgattgaacacaactatggaggc
cacgacgacgacttatctgtacggcactgcactaacgcgtacatgttggtttacatcagg
gaatcgaaattaagtgaagtcttgcagcctgttacggaccatgatattcctcagcaactt
gtggaaaggctacaagaagagaaaagaatagaggctcagaagaggaaggagaggcaggaa
gctcacctctacatgcaagtgcagatagtagcagaggatcagttctgcggccaccaaggc
aatgacatgtatgatgaagaaaaagtgaaatacaccgttttcaaagtattaaaaaactcc
acgttgacagaatttgttcaaaacctctctcaaacaatgggatttccccaggatcagatc
agattatggccaatgcaagctagaagtaatggaacaaaaagacctgcaatgttagataat
gaagcagatggcaataaaacaatgattgagctcagcgacaatgaaaatccatggacaata
tttttggaaacagtagatccagagatggctgctactggagcaacattacccaagtttgat
aaagatcatgatgtaatgttgtttctgaagatgtatgatccgaaaactcggagtttgaat
tattgtggacatatctacacacctatatcctgtaaaatacgtgacttgcttccagttatg
tgtgagagagcaggatttccacaagaaactaaccttatcctctatgaggaagttaaaccc
aatttaacagaaaggattcaagactatgatgtgtctcttgataaagctcttgatgaactc
atggatggtgacatcatagtgtttcagaaggatgacccagaaaacgataacagtgagctg
ccaacagctaaggaatacttcagagacctctatcatcgtgtggatgtcattttctgtgat
aaaaccatccccaacgaccctggttttgttgttactttgtccaataggatgaattacttt
caggttgcaaagacagttgcacaaagacttaatacagatccaatgctattacagtttttc
aagtctcaaggttatagggacggccctggtaatccccttaggcacaattatgaaggtact
ttaagagatcttctgcagttcttcaagcctaggcaacctaaaaagctttactatcaacag
ctcaaaatgaaaataactgattttgaaaacagaagaagttttaaatgcatatggctaaat
agccaatttagggaagaggaaataacagtatatccagataagcatgggtgtgtgcgggac
ctcttagaagaatgtaaaaaagttgtagagctctctgaaaaaggttcagggaaattaagg
ctgctagaaattgtaagttacaaaataattggcgtccatcaggaagatgagctgttagag
tgtttgtcacccgcaacaagtcgaacgtttcgaatagaggaaattcctctggaccaggta
gatatagataaagaaaatgagatgctaatcacagtggcacatttccacaaggaggttttt
gggacatttggaattccgttcttgctgaggatacaccagggcgaacacttcagagaggtt
atgaagcggattcagacaatgctggacatacaggaaaaagaatttgaaaagtttaaattt
gcaattgtaatgatgggccgacaccaatatctcaatgaagatgagtatgaagtgaacttg
aaagattttgagccccaaccaggcaacatgtctcatccaaggccgtggctagggcttgac
catttcaataaagccccaaagagaagtcgctacacttaccttgaaaaagctattaaaatc
cataactga

DBGET integrated database retrieval system