KEGG   Gallus gallus (chicken): 395549Help
Entry
395549            CDS       T01006                                 

Gene name
DBH
Definition
(RefSeq) dopamine beta-hydroxylase
  KO
K00503  dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00350  Tyrosine metabolism
gga01100  Metabolic pathways
Module
gga_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    395549 (DBH)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     395549 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu2_monoox_C Cu2_monooxygen DOMON
Motif
Other DBs
NCBI-GeneID: 395549
NCBI-ProteinID: XP_415429
CGNC: 2115
Ensembl: ENSGALG00000040045
Position
17
AA seq 632 aa AA seqDB search
MAKARRVGAILPSMQTHGSMLSPCSSFRLRELASMYFTMVAVFLVILVVAMQGLAPSNTH
FPYKVSLDPQGLLELSWNVSYPEQAVYFQILIKKFRFGLLFGMSDRGEFENADLAVLWTD
GHSSYFGDAWSDAQGQLHMDSQQDYQLLGAQKAPEGLYLLFRRAFSTCDPKDYLIEDGTV
HLIYGILENPVHSLHAINISTMYRGLQRVQLLKPDITIPVLPRDVKIMEITTPSIVIPSQ
ETTYWCYIRELPDNFTKHHIIMYEPVITAGNEALVHHMEIFQCTTESVNIPHYNGQCDSK
MKPEQLNYCRRVLAAWAMGAQAFYYPEEAGVAFGGPGSSRHLRLEIHYHNPLIFRGRRDS
SGIRLYYTDKLRSHDAGIMELGLVYSPLMAVPPGETAFILTGYCTDKCTQKALPEGGIRI
FASQLHTHLAGRKVVTVLSREGRELQVVNADGHYSPHFQEIRMLKELVAVFPGDELITSC
TYNTENRSNATVGGFGIMEEMCVNYVHYYPQTQLELCKSTTDPGYVQRYFNTVNRFNDEE
VCMCPRVSVPQQFSSVPWNTFNKQILKSVYNFAPISMHCNKSSAVRFPGQWEKQPLPSIT
KTLREPKPHCPPTPEPRPAVPVPINLGHFRRG
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagccaggagggtgggtgccatcctgcccagcatgcagacccacggcagcatg
ctgtccccctgctccagcttcaggctgcgggagctggcatccatgtacttcaccatggtg
gctgtgttcctggtcatcctggtggtggccatgcagggcttggcgcccagcaacacccat
ttcccctacaaggtgtccctcgatccccaggggctgctggagctctcgtggaacgtcagt
taccccgagcaagccgtgtatttccagatcctcatcaagaagttcaggtttgggctcctc
tttgggatgtcggaccggggtgagtttgagaacgcagacctggccgtgctctggactgac
ggccacagttcatattttggggatgcctggagcgatgcccaggggcagctgcacatggac
tcccagcaggactaccagctgcttggggctcagaaggcccccgaaggactctacctgctc
ttcagaagagccttcagcacctgtgaccccaaggactaccttatagaggatggcaccgtg
caccttatttacgggatcctggagaaccccgtccattccctccacgccatcaacatctct
accatgtacagagggctgcagagagtgcagctgctgaagcccgacatcaccatccctgtg
ctgcccagagatgtgaagatcatggagataacgacccccagtattgttattcccagccaa
gagacgacctactggtgttacatcagagagctgccggacaacttcaccaaacaccacata
atcatgtatgagccagtgatcacagcgggcaatgaagccctagtccaccacatggaaatc
ttccagtgcacaaccgagtctgtcaacatcccccattacaacggtcaatgtgactccaag
atgaagccagagcagctcaactactgcaggcgtgtgcttgcagcatgggccatgggagca
caggctttctactaccccgaagaagcaggagttgcctttggtggtccaggctcctccaga
catttgcgccttgagattcactaccacaatccactgatattcagagggcgccgtgattcc
tcggggatccgcctgtactacacagacaaactgcgttcccacgatgctggcatcatggag
ctgggcttggtctactcgccgctgatggccgtgcccccaggggagactgccttcatcctc
actgggtactgcaccgacaaatgcacccagaaggcactgcctgaaggtgggatccgcatc
ttcgcctcccagctccacactcatctggcagggaggaaagtggtgaccgtgctgtcacgg
gaaggcagagagcttcaggtggtgaacgctgatgggcactacagcccccacttccaggag
atccgcatgctgaaggagttggtcgcagtctttccgggtgacgaactcatcaccagctgt
acctacaacacagagaacaggagcaatgcgacagtgggtgggttcggcatcatggaggag
atgtgcgtgaattacgtgcactactacccccagacacaactggagctctgcaaaagcacc
acggatccaggctatgtgcaacgctactttaacaccgtcaacaggtttaatgatgaggag
gtctgcatgtgcccgcgggtctctgtcccacagcagttctcctccgtcccttggaacaca
ttcaacaaacaaatactgaaatccgtctacaactttgctcccatctcaatgcactgcaat
aaatcctcagctgtgcgcttcccgggtcagtgggagaagcagccgcttcccagcatcacc
aagacactgcgggagcccaaacctcactgcccgcccaccccagagcctcgtcctgctgtc
cccgtgcccatcaacctgggtcacttcaggaggggctga

DBGET integrated database retrieval system