KEGG   Gallus gallus (chicken): 395896Help
Entry
395896            CDS       T01006                                 

Gene name
EFNB1
Definition
(RefSeq) ephrin-B1
  KO
K05463  
ephrin-B
Organism
gga  Gallus gallus (chicken)
Brite
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   395896 (EFNB1)
Cytokines [BR:gga04052]
 PDGF family
  Other growth factors
   395896 (EFNB1)
Cell adhesion molecules and their ligands [BR:gga04516]
 7. Others
  EPHA4, SEK, TYRO1; Eph receptor A4 [KO:K05105]
   395896 (EFNB1)
  EPHB1, ELK, NET; Eph receptor B1 [KO:K05110]
   395896 (EFNB1)
  EPHB2, ERK, DRT; Eph receptor B2 [KO:K05111]
   395896 (EFNB1)
  EPHB3; EPHB3, HEK2, ETK2; Eph receptor B3 [KO:K05112]
   395896 (EFNB1)
  EPHB4; EPHB4, HTK; Eph receptor B4 [KO:K05113]
   395896 (EFNB1)
  EPHB6; Eph receptor B6 [KO:K05114]
   395896 (EFNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
4
AA seq 334 aa AA seqDB search
MARPRGGRWLLGVLLALCRLAAPLAKSLEPVSWSAGNPKFMSGKGLVIYPEIGDKLDIIC
PKAEPSKPYDYYKLYLVKKDQADACSTVMDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGL
EFKRQQDYFITSTSNGTLDGLENREGGVCQTRSMKIVMKVGQDPNAVIPEQLTTSRPSKE
ADNTVKIVTQSPRHKVPTVEEPGKPGSVNQNGQETQGPSDGFLSSKVAVFAAIGAGCVIF
ILIIIFLVVLLIKIRKRHRKHTQQRAAALSLSTLASPKCSGNAGSEPSDIIIPLRTTENN
YCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggccccgcggcgggcggtggctgctgggggtgctgctcgccctgtgccgcctg
gccgcgccgctcgccaagagcctggagcccgtctcttggagcgccggcaaccccaaattc
atgagtgggaaagggttggtcatctacccggagattggggacaaactggacattatctgc
cccaaggcggagccgtccaagccttacgattactacaagctgtacctggtgaaaaaggac
caggcagatgcctgcagcaccgtcatggaccccaacgtgctggtgacgtgcaaccggccc
gagcaggagatccgcttcaccatcaagtttcaggagttcagccccaactacatgggcctg
gagttcaagcggcagcaggattacttcatcacatccacctctaatgggacactggatggc
ctggagaaccgggaaggaggggtctgccagacacgctccatgaagatcgtcatgaaagtg
gggcaggatccaaacgcggtgatcccggagcagctgacgacgagtcggcccagcaaggag
gcagacaacaccgtgaagattgtgacgcagagcccacgccacaaagtccccacggtggag
gagcccggcaagccaggttccgtcaaccagaacggccaggagacccaaggtcccagcgat
gggttcctgagctccaaagtcgccgttttcgctgccatcggcgcgggctgcgtcatcttc
atcctcatcatcatcttcctcgtcgtcctcctgatcaagatccgcaagcggcaccggaag
cacacgcagcagcgggccgcagccttgtccctcagcaccttggccagccccaaatgcagc
gggaacgccggctcagagcccagcgacatcatcatccccttacggactacagagaacaac
tactgcccgcactacgagaaggtgagcggggactacgggcaccccgtctacatcgtgcag
gagatgcccccacagagcccagccaacatttactacaaggtgtga

DBGET integrated database retrieval system