KEGG   Gallus gallus (chicken): 395979Help
Entry
395979            CDS       T01006                                 

Gene name
ADH6, ADH1A, ADH1B
Definition
alcohol dehydrogenase 6 (class V) (EC:1.1.1.1)
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    395979 (ADH6)
  Lipid metabolism
   00071 Fatty acid degradation
    395979 (ADH6)
  Amino acid metabolism
   00350 Tyrosine metabolism
    395979 (ADH6)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    395979 (ADH6)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    395979 (ADH6)
   00982 Drug metabolism - cytochrome P450
    395979 (ADH6)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     395979 (ADH6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
4
AA seq 376 aa AA seqDB search
MATSGKVIRCRAAVAWAAGKSLSVEEIEVAPPKAREVRVKMVATGICHTDEHVLEGNFPD
VDFPVILGHEGAGIVESIGEGVTSVKPGDKVILFPLPQCGECSFCLNPDSNYCLKSHLTE
PQNLMPDKTTRFTCKGKQIQHFLWNSTFAEYTVVPEYTLAKIDAAAPLDKVCVFACGFST
GYGAAVNTAKVKLGSTCAVFGLGGVGLSVVMGCKAAGASRIIAIDINKDKFAKAKEMGAT
ECINPQDFKKPIQQVLTEMTGHGVDYSFEAIGTADTLIAALASCNMNTGVCVMVGVLPAG
STVPIDPFLLLSGRTCKGTLAGGWKMRDSIPKLVASYLEKKFNSDLLITHTLPFAKINEG
FELLRAGKSIRTVMLF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggccacttctggaaaagttatccgatgcagagctgcagttgcctgggcagcgggcaaa
tcactctctgttgaggagatagaggttgcacctccaaaggcacgtgaagtgcgtgtcaag
atggtggccacggggatctgccacacagatgaacatgttctagaaggtaactttcctgac
gtagatttcccagtcatcctaggccacgaaggagctgggattgtggagagcattggagaa
ggagtgacctccgtgaagccaggagacaaagtcatcctctttccacttcctcagtgtgga
gaatgcagcttctgcttgaatcctgactccaactactgcctgaaatcacacctcactgaa
ccacaaaacctgatgcctgacaagaccaccaggttcacttgcaaagggaaacagatccaa
cacttcctctggaacagcacttttgcggaatacactgttgtacctgagtacaccctggcc
aagatagatgctgctgcacctctggacaaagtctgtgtgtttgcctgtggtttctccaca
ggctatggggctgctgtcaacaccgccaaggtaaaactgggctccacctgtgccgtcttt
ggccttggaggagtcggcctctctgttgtcatgggctgcaaggcagctggagcgtcccgc
atcattgccatcgatatcaacaaggacaagtttgccaaggccaaagagatgggagccacc
gagtgcatcaaccctcaggacttcaagaagcctatccagcaggtgctcaccgagatgacc
ggtcacggcgtggactactcctttgaagccattgggaccgcagataccctgattgctgcc
ctggcctcttgcaatatgaacaccggggtctgtgtgatggttggagtattacctgctggt
tcgacagttcccattgatcctttccttctactaagtgggcgcacctgtaaaggaaccctg
gctggaggctggaaaatgagagactctatccccaaattagttgccagctatttggagaag
aaatttaactctgacttgctgatcacacacacgctgccgtttgctaaaatcaacgaggga
tttgaattgctacgtgcaggcaaaagcattcgcaccgtgatgctcttctga

DBGET integrated database retrieval system