KEGG   Gallus gallus (chicken): 396349Help
Entry
396349            CDS       T01006                                 

Gene name
MAP2K2, MEK2
Definition
mitogen-activated protein kinase kinase 2 (EC:2.7.12.2)
Orthology
K04369  
mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Vascular smooth muscle contraction
VEGF signaling pathway
Gap junction
Toll-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Melanogenesis
Influenza A
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    396349 (MAP2K2)
   04012 ErbB signaling pathway
    396349 (MAP2K2)
   04370 VEGF signaling pathway
    396349 (MAP2K2)
   04068 FoxO signaling pathway
    396349 (MAP2K2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    396349 (MAP2K2)
  Cellular commiunity
   04540 Gap junction
    396349 (MAP2K2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    396349 (MAP2K2)
  Endocrine system
   04910 Insulin signaling pathway
    396349 (MAP2K2)
   04912 GnRH signaling pathway
    396349 (MAP2K2)
   04916 Melanogenesis
    396349 (MAP2K2)
  Circulatory system
   04270 Vascular smooth muscle contraction
    396349 (MAP2K2)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    396349 (MAP2K2)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     396349 (MAP2K2)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   396349 (MAP2K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
28
AA seq 398 aa AA seqDB search
MPAKRKPVLPALTITPSPAEGPGPGGSAEANLVDLQKKLEELELDEQQKKRLEAFLTQKA
KVGELKDDDFERISELGAGNGGVVTKVQHKPSGLIMARKLIHLEIKPAIRNQIIRELQVL
HECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLA
YLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGT
HYSVQSDIWSMGLSLVELSIGRYPIPPPDSKELEAIFGRPVVDGAEGESHSVSPWARPPG
RPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTQDFQEFVNKCLIKNPAERADLKM
LMNHTFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRAAV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaagaggaagccggtgctgccggccctcaccatcactcccagccccgccgag
ggacccgggcccggcggttctgcagaggccaacctggtggaccttcagaagaagctggag
gagctggagctggatgagcagcagaagaagcgcttggaagctttcctcactcagaaagcc
aaagtgggagagctgaaggacgatgactttgagaggatctccgagctgggggctggcaac
ggtggtgtggtcaccaaagtgcaacacaaaccctcaggactcattatggcacggaagctg
attcatctagaaatcaaaccagccatcaggaatcagattatccgagagctgcaggtgctg
catgagtgtaattccccatacattgtgggtttctatggggccttctacagcgatggagag
atttccatctgcatggagcacatggatggtggctccctggatcaagtgttgaaagaagcc
aaaagaatccccgaggaaatactggggaaagtcagcatagcagttctgagaggtttggcc
tatctgagagagaagcaccaaatcatgcacagagatgtgaagccttccaacatcctggtt
aactctcgaggagagattaagctgtgtgattttggggtcagtggtcaactcattgactcc
atggcaaactcttttgtgggaactcggtcctacatgtctcctgaacggttgcagggcacc
cattactcagtccagtccgacatctggagcatgggtctgtcactggtggagctttctatt
ggaaggtaccccatacccccaccagactccaaggaactggaagcaatatttggccgtccc
gtggtggatggggcagagggagaatctcacagcgtctcgccgtgggccagacccccagga
cgccccatcagtggccatggaatggacagccgacctgcaatggccatctttgaactgctg
gactatatcgttaatgagccacctcccaagttgccaaatggagttttcacgcaagatttc
caggagtttgtaaataaatgcttaattaagaatccagcggaacgggcagatttgaagatg
ctgatgaatcacaccttcatcaaacgctccgaagtggaggaggtggatttcgccggctgg
ctgtgcaaaacactgaggttaaaccagcccagcacacccacccgtgctgccgtgtga

DBGET integrated database retrieval system