KEGG   Gallus gallus (chicken): 396402Help
Entry
396402            CDS       T01006                                 

Gene name
EPHA3, CEK4, ETK1
Definition
(RefSeq) EPH receptor A3
  KO
K05104  
Eph receptor A3 [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     396402 (EPHA3)
Protein kinases [BR:gga01001]
 Tyrosine protein kinases
  Eph family
   396402 (EPHA3)
Enzyme-linked receptors [BR:gga01020]
 Receptor tyrosine kinases
  RTK class VIII (EPH receptor family)
   396402 (EPHA3)
Cytokine receptors [BR:gga04050]
 Receptor tyrosine kinase
  RTK class VIII (EPH receptor family)
   396402 (EPHA3)
Cell adhesion molecules and their ligands [BR:gga04516]
 7. Others
  EFNA; ephrin-A [KO:K05462]
   396402 (EPHA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 983 aa AA seqDB search
MDRRRLPLLLLCAALGSAGRLSARPGNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEH
YTPIRTYQESNVMDHSQNNWLRTNWIPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFN
LYYMESDDDHLAKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEVREVGPVSKKGFYL
AFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNHSKEEEPPK
MYCSTEGEWLVPIGKCLCNAGYEERGFACQACRPGFYKASAGNVKCAKCPPHSSTYEDAS
LNCRCEKNYFRSEKDPPSMACTRPPSAPRNVISNINETSVILDWSWPLDTGGRKDVTFNI
ICKKCGGSSKICEPCSDNVRFLPRQTGLTNTTVTVVDLLAHTNYTFEIDAVNGVSDLSTL
SRQFAAVSITTNQAAPSPITVIRKDRTSRNSVSLSWQEPEHPNGIILDYEVKYYEKQEQE
TSYTILRAKSTNVTISGLKPDTTYVFQIRARTAARYGTSSRKFEFETSPDSFSISSENSQ
VVMIAISAAVAIILLTVVVYVLIGRFCGYKKSKHGTDEKRLHFGNGHLKLPGLRTYVDPH
TYEDPNQAVHEFAKELDASNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKAGYT
EKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTV
IQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYT
TRGGKIPIRWTSPEAIAYRKFTSASDAWSYGIVLWEVMSYGERPYWEMSFQDVIKAVDEG
YRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPSSLKIITNAAARPSN
LLLDQSNIDISAFRTAGDWLNGFRTGQCKGIFTGVEYSSCDTIAKISTDDMKKVGVTVVG
PQKKIVSSIKTLETHTKNSPVPV
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atggaccgccgccgcctgccgctgctgctgctctgcgctgccctcggctccgccgggcgt
ctgagcgcccgccccggcaacgaagttaatctgctggattcaaaaacaattcaaggggag
ctgggctggatctcctacccatcacatgggtgggaagagattagtggtgttgatgagcat
tatactccaatcagaacttaccaagagagcaatgttatggatcacagtcaaaacaattgg
ctgcgaacaaactggattccacgcaattcagcgcagaagatatatgtggagctcaagttt
accttgagggactgcaatagtatccctctagttctgggcacttgcaaagagactttcaat
ctgtattacatggaatccgatgatgaccatttggcaaagttcagagagcaccaatttacg
aagattgacaccattgcggctgatgagagcttcacccagatggatcttggggaccggatt
ctcaagctgaataccgaagtccgcgaggtgggacctgttagtaagaagggcttttacttg
gctttccaagatgtaggtgcatgtgttgccttagtctcggtgcgagtgtacttcaagaag
tgccctttcactgtcaagaacctcgccatgtttccagatacagttcctatggactcccag
tccctggtggaggtgcggggttcttgtgtcaatcattccaaggaggaagagccacccaag
atgtactgcagcacggaaggagaatggctagtgcccatagggaagtgcttgtgtaatgct
ggctatgaagagagaggctttgcgtgccaagcttgtcgacctgggttctataaagcttct
gctggcaatgtgaagtgtgccaaatgcccacctcacagctctacctatgaagatgcatct
ctgaactgcaggtgtgaaaagaattactttcgctctgagaaagaccctccatccatggct
tgcaccagaccaccatctgctccaagaaacgttatttctaacatcaatgagacatctgtt
attctggactggagctggcctcttgatacaggaggtcgaaaagatgtcactttcaacatc
atttgcaaaaaatgtggaggaagcagcaagatatgtgagccttgcagtgacaacgtacgg
ttcttaccccgtcagactggcctcaccaacaccacggtgacagtagtggaccttttggca
cataccaattacacttttgagattgatgcagtcaacggggtatctgacttgagtacactt
tcgagacaatttgctgctgtcagcatcacgactaatcaggctgcgccatcccccatcaca
gtgataaggaaagaccggacatccaggaacagcgtgtctctgtcttggcaggagcctgag
cacccaaatggaatcatcttggactacgaggtcaaatactacgaaaagcaggaacaagag
acaagctatactattctgagagccaaaagcactaacgttactatcagcggcctcaaacct
gataccacctacgtcttccaaattcgagcccgaactgcagctagatatgggacaagcagc
cgcaagtttgaatttgaaaccagtccagattcattctccatttccagtgaaaatagccag
gtcgttatgattgccatttcagctgcagttgccatcattctcctcacggttgttgtgtac
gtcttgattgggagattctgcggatacaagaagtctaaacatggtaccgatgagaaaaga
ctacattttgggaatggccacttaaaactcccaggcctgagaacttatgtagatccacat
acgtacgaagatcccaatcaagctgtacatgaatttgccaaggaactagatgcttctaat
atatcaattgataaagttgttggagcaggggaatttggagaagtgtgcagtgggcgcctg
aagctgccttctaaaaaggaaatttcagtggccatcaaaactctgaaagctggctacaca
gaaaaacagagaagggatttcctgggagaagcaagcatcatggggcagtttgaccacccc
aacatcatccgactggagggcgttgtgactaaaagtaaaccagttatgattgttactgaa
tacatggaaaacggttccttggacagcttcctacggaaacatgatgcccagttcacagtc
attcagctagtaggcatgcttcgtgggatcgcatctggcatgaaatatttgtcagatatg
ggttatgtccaccgagatctagctgctcgtaatatactcatcaatagtaacttggtgtgc
aaagtctcagattttggtctttctcgtgtattggaagatgacccagaagctgcttacaca
acaagggggggcaagattcccatccgatggacgtcaccagaagccattgcataccggaag
ttcacatcagccagtgatgcgtggagctatgggattgtcctctgggaggtgatgtcttat
ggagaaaggccgtactgggagatgtccttccaggacgtaattaaagccgttgatgaaggg
tatcgcttgccacctcctatggactgcccagctgccttgtatcagctgatgctggactgc
tggcagaaagacagaaacaacagacccaagtttgagcagattgtcagcatcctggataag
ctgatccgtaatcccagcagtctgaaaataatcaccaatgcggcagcaaggccatcaaat
cttctcctggaccaaagtaacattgacatttcagcgttccgcacggcaggtgattggctc
aatggttttcgaacaggacagtgcaaaggcattttcacgggtgtggagtacagctcctgt
gatacaatagccaagatttccactgatgacatgaagaaagttggtgttacagttgtgggg
cctcaaaagaagattgttagcagtatcaaaactctagaaactcatacgaagaacagccct
gttcctgtgtaa

DBGET integrated database retrieval system