KEGG   Gallus gallus (chicken): 415805Help
Entry
415805            CDS       T01006                                 

Gene name
PLCG2
Definition
phospholipase C, gamma 2 (phosphatidylinositol-specific)
Orthology
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:gga00562]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:gga04012]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:gga04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:gga04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:gga04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
11
AA seq 1378 aa AA seqDB search
MGTCRNWGESAFRFRFLSNLCVQGRHLRRPAAQEWFSCAHLKCPLPTCCTFACLQLFLSL
FYQMSVRLWELFCRRAAVLLLCTAVSSSSWSAASEETSTVKTIQVGLKKKPKKMPRKSVD
YGELPEYEKSQIKRTLELGTVMTVFSIKKSSLERRTIQVIMETRQVAWSKTADKIEGFLD
LMEIKEIRPGKNSKDFERCKAKHREEHCFTIFYGTQFVLNTLSLAADSKGDADKWLCGLN
ILYQEVMRAPTPAITESWLRKQIYSVDQTRRNSISLRELKAVLPQVNFKVSSMKFLKDKF
AEIGAHKEELSFEQFHLFYKKIMFEQQKSILDEFKKDSSVFILGNTDRPDASAVHLHDFQ
RFLLHEQQESWAQDLSKVRERMTEFVDDTMRETAEPFLFVDEFLTYLFAKENSIWDEKYD
TIDVQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDCWDGPDGK
PIIYHGWTRTTKIKFDDVVQAIKDHAFVTSEYPVILSIEEHCSVEQQRHMAKVFKEVFGD
QLLMKPVEASADQLPSPTQLKEKIIIKHKKLGPKGDIDVNLEDKKEEKKQQGELYMWDAI
EQQWTRHYCAIADGKLSFSDVIEQNADEDSSKEVKRTELHLKEKWFHGKMKEGRTTAEKL
LQEYCAEMGGKDGTFLVRESEAFPNDCTLSFWRSGRVQHCRIRSSSDGDTVKYYLTDNVT
FDSIYDLIQHYKEVHLRCAEFDLRLTDAVPNPSPHENKDWYYSNLSRGEAEDMLMRIPRD
GAFLIRKRDEPDSFAMTFRAEGKVKHFRIQQEGRHFVLGTSAYFESLVELVTYYEKHPLY
RKMKLRYPVTEELLERYSTEKDINSLYDVKMYVEPSEITPTVPQRTVKALYDYRAKRSDE
LSFSRGALIHNVTKETGGWWKGDYGEKVQHYFPSNYVEDLSSDNSAELESQIIEDNPLGS
LCHGILVLNTYNVVKMPQGKHKKPFVFILEPKNPEDPCVEFATDKVEELFEWYQSVREIT
WKTAEEENRRKYWEKNQLIAIELSDLVIYCKPTSKTKDNLENPDFKEIRSFVETKAESIV
KQKPVELLKYNLKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKYMQLNHAL
FSLNGHTGYVLQPESMRNEEYDPMPNESKRKLQMIMTVRVLGARHLPKLGRSIACPFVEV
EICGAEYDNNKFKTTVVNDNGLNPVWAPCPEQVKFEIYDPNLAFLRFVVYEEDMFSDPNF
LAHATFPIKGIKSGFRSVPLKNGYSEDIELASLLIHCEMQQVLEYEEELYSSCRQLRKRQ
EELNNQLFLYDTHMNLRNPNRDALLREFNVNEHKLQMCQETCNRRLREKKVSNSKFYS
NT seq 4137 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgtgtagaaactggggcgagtctgccttcagattccgctttttgagcaacctt
tgtgtgcagggaaggcacctgcggcgtcctgcggctcaggagtggttcagctgtgctcat
ctgaaatgtccgttgccaacctgctgtactttcgcctgcctgcagctctttctctctctg
ttctatcagatgtctgtacggctttgggaacttttctgtaggagagcagcggtgcttctg
ctttgcacagcggtgtcttctagctcatggtccgctgcttcagaggaaaccagcacagtg
aaaaccatacaagttggattgaaaaagaaacctaagaaaatgcctcgaaagagtgtagat
tatggagagctgccggagtatgagaaaagccagatcaaaaggacgttggagctgggaact
gttatgacagtattcagtattaagaagagtagtctagaaagaaggactattcaggttata
atggaaaccaggcaggtagcctggagcaagacagctgacaagatcgaaggtttcttggat
ctgatggaaatcaaagaaattcgcccaggaaagaattcaaaggactttgaacgatgcaaa
gcaaaacacagagaagaacactgcttcactattttttatggtacccagtttgtcctcaat
accttaagtttagcagctgattctaaaggtgatgctgataaatggttgtgtggcttgaat
atcttgtatcaagaggtcatgagagctcccacacctgcaatcacggagagctggctgaga
aagcaaatctattctgttgatcagactagaagaaacagcatcagtcttagagagctgaaa
gctgtccttccccaagtaaacttcaaagtgagcagcatgaagttcttgaaggataaattt
gcggaaataggtgctcacaaggaagagcttagttttgaacaatttcatttgttctacaaa
aagatcatgtttgaacaacagaaatcgattctcgatgaattcaagaaggattcctctgtg
ttcattcttggaaatactgaccgtccagatgcttcagcagttcatctccatgactttcag
aggtttctcctacatgagcagcaggaatcttgggcacaagatctgagtaaagtccgagaa
cgaatgactgagtttgttgatgacactatgagagaaactgctgaacccttcctctttgtt
gatgagttcctcacttacctttttgcaaaagaaaacagtatttgggatgagaaatatgat
acaatagatgtgcaggacatgaataatcctttgtcccactactggatttcttcctctcat
aacacatatctgacaggagaccagcttcgaagtgaatcctccacagaagcttacatcagg
tgtcttaggatgggatgccgatgtattgagttggactgctgggatggtcctgatgggaag
cccatcatttaccatggatggacacggacaacaaagatcaaatttgatgatgtagtgcag
gcaatcaaagatcacgcttttgttacatctgagtacccagtcattctgtcaattgaagag
cactgtagtgtagaacagcaacgacacatggccaaagtgttcaaggaggtatttggggat
cagcttttaatgaaacctgttgaagctagtgcagatcagctgccatcaccaactcaactg
aaagaaaaaatcatcatcaagcacaaaaaactggggccaaagggagacattgatgtcaac
ctggaagacaagaaagaagaaaaaaaacaacaaggagaactttacatgtgggatgcaata
gaacagcaatggactcggcattactgtgctattgctgatggaaagctttcattcagtgat
gtcatagaacagaatgctgatgaagattcatcgaaggaggtaaaacgtactgaactgcac
ttaaaggagaaatggttccatggaaaaatgaaagaggggagaacaactgctgagaagctg
ctccaagagtattgtgctgaaatgggtggcaaggatggaacattcctagttagggagagc
gaggctttccctaatgattgcaccttgtcattctggagatcaggtagagtccagcattgc
cgtatccgttcttcaagtgatggggacactgtgaaatactacctgacagacaatgtcact
tttgatagcatctatgatctcattcaacactacaaggaggtccacttgaggtgtgctgaa
tttgatctgcgtctcaccgatgctgtgcctaatcccagccctcatgaaaataaagattgg
tactatagcaacttgagtcgaggagaggcagaagacatgctgatgagaattcctcgagat
ggagcctttctaattagaaagagagatgagcctgattcatttgccatgactttcagagct
gaggggaaggtgaagcacttccgaattcagcaagaaggtcgccattttgtgcttggaacg
tcagcctactttgagagtttagtggagctggtaacatactatgagaagcaccctctgtac
aggaaaatgaaattacgttaccctgtgactgaggagctgctggagcgctacagcacagaa
aaagatattaactctctttatgatgtcaagatgtacgtggaacccagtgaaatcacccct
acagtgcctcagagaacagtgaaagccttgtatgactacagagccaaacgaagtgatgaa
ttgagcttcagtcgcggagctctgattcataatgtcacaaaggaaactggaggctggtgg
aaaggggattatggagaaaaagtccaacactattttccatctaattacgttgaagaccta
tcatctgataattctgctgagcttgaaagccagattattgaggacaatccattaggatct
ctgtgtcatggcatattggtactaaatacctacaatgttgtgaaaatgccacaagggaaa
cacaaaaagccttttgtcttcattttggaacctaagaatccagaagatccgtgtgttgaa
tttgcaactgataaagtagaagaactgtttgaatggtaccaaagtgtccgtgaaatcaca
tggaaaactgcagaagaggagaacaggaggaaatactgggaaaagaatcaattgattgct
attgaattatctgatctggtaatctactgcaagccaacaagcaaaaccaaggacaattta
gaaaatcctgatttcaaagaaatacgttcctttgtggaaaccaaggcagaaagtattgtt
aagcaaaagccggttgagttgctgaaatacaacttgaagggactgacacgtgtctatcct
aaaggacagagggttgactcatcaaactatgacccatttcgcctctggctttgtggctct
cagatggtggctcttaactttcagactccagataaatacatgcaattgaaccatgccttg
ttttcacttaatggacacactggctatgttctgcagccagaaagcatgagaaatgaagag
tatgacccaatgccaaatgaatcgaagaggaaattgcagatgattatgacagtgagggtt
ttaggtgctcgtcatctccctaagcttggtagaagcattgcgtgtccctttgtagaggta
gaaatatgtggggctgagtatgataacaacaaattcaagacaacagttgtgaatgacaat
ggtcttaatccagtttgggcaccctgtccggagcaagtgaaatttgaaatttatgatcca
aatctagcatttttgcgctttgttgtttatgaggaggatatgttcagtgaccccaatttc
ttagcacatgccacttttcccatcaaaggaatcaaatcaggttttaggtcagttcctctc
aagaatggttacagtgaagacatagagctagcctcactgctgattcactgtgaaatgcag
caagttctggaatatgaagaagagctttattcttcgtgtcggcaacttcggaagcgccag
gaggagcttaataaccagctattcctttatgatacccatatgaatttaaggaatcctaac
agagatgcattattaagagaattcaacgtgaatgaacacaaactacaaatgtgtcaagaa
acgtgtaaccggagattaagggagaagaaagtcagtaacagcaaattctactcttaa

DBGET integrated database retrieval system