KEGG   Gallus gallus (chicken): 415805Help
Entry
415805            CDS       T01006                                 

Gene name
PLCG2
Definition
(RefSeq) phospholipase C gamma 2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00562  Inositol phosphate metabolism
gga01100  Metabolic pathways
gga04012  ErbB signaling pathway
gga04020  Calcium signaling pathway
gga04070  Phosphatidylinositol signaling system
gga04370  VEGF signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04933  AGE-RAGE signaling pathway in diabetic complications
Module
gga_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    415805 (PLCG2)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    415805 (PLCG2)
   04370 VEGF signaling pathway
    415805 (PLCG2)
   04020 Calcium signaling pathway
    415805 (PLCG2)
   04070 Phosphatidylinositol signaling system
    415805 (PLCG2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    415805 (PLCG2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    415805 (PLCG2)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     415805 (PLCG2)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    415805 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    415805 (PLCG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 SH3_2 PH_12 GDPD EF-hand_like
Motif
Other DBs
NCBI-GeneID: 415805
NCBI-ProteinID: XP_004944315
CGNC: 4062
Ensembl: ENSGALG00000033507
UniProt: A0A1D5PHP4
Position
11
AA seq 1265 aa AA seqDB search
MPRKSVDYGELPEYEKSQIKRTLELGTVMTVFSIKKSSLERRTIQVIMETRQVAWSKTAD
KIEGFLDLMEIKEIRPGKNSKDFERCKAKHREEHCFTIFYGTQFVLNTLSLAADSKGDAD
KWLCGLNILYQEVMRAPTPAITESWLRKQIYSVDQTRRNSISLRELKAVLPQVNFKVSSM
KFLKDKFAEIGAHKEELSFEQFHLFYKKIMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQESWAQDLSKVRERMTEFVDDTMRETAEPFLFVDEFLTYLFAKENS
IWDEKYDTIDVQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSEYPVILSIEEHCSVEQQRHMAKV
FKEVFGDQLLMKPVEASADQLPSPTQLKEKIIIKHKKLGPKGDIDVNLEDKKEEKKQQGE
LYMWDAIEQQWTRHYCAIADGKLSFSDVIEQNADEDSSKEVKRTELHLKEKWFHGKMKEG
RTTAEKLLQEYCAEMGGKDGTFLVRESEAFPNDCTLSFWRSGRVQHCRIRSSSDGDTVKY
YLTDNVTFDSIYDLIQHYKEVHLRCAEFDLRLTDAVPNPSPHENKDWYYSNLSRGEAEDM
LMRIPRDGAFLIRKRDEPDSFAMTFRAEGKVKHFRIQQEGRHFVLGTSAYFESLVELVTY
YEKHPLYRKMKLRYPVTEELLERYSTEKDINSLYDVKMYVEPSEITPTVPQRTVKALYDY
RAKRSDELSFSRGALIHNVTKETGGWWKGDYGEKVQHYFPSNYVEDLSSDNSAELESQII
EDNPLGSLCHGILVLNTYNVVKMPQGKHKKPFVFILEPKNPEDPCVEFATDKVEELFEWY
QSVREITWKTAEEENRRKYWEKNQLIAIELSDLVIYCKPTSKTKDNLENPDFKEIRSFVE
TKAESIVKQKPVELLKYNLKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
MQLNHALFSLNGHTGYVLQPESMRNEEYDPMPNESKRKLQMIMTVRVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLNPVWAPCPEQVKFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATFPIKGIKSGFRSVPLKNGYSEDIELASLLIHCEMQQVLEYEEELYSSC
RQLRKRQEELNNQLFLYDTHMNLRNPNRDALLREFNVNEHKLQMCQETCNRRLREKKVSN
SKFYS
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgaaagagtgtagattatggagagctgccggagtatgagaaaagccagatcaaa
aggacattggagctgggaactgttatgacagtattcagtattaagaagagtagtctagaa
agaaggactattcaggttataatggaaaccaggcaggtagcctggagcaagacagctgac
aagatcgaaggtttcttggatctgatggaaatcaaagaaattcgcccaggaaagaattca
aaggactttgaacgatgcaaagcaaaacacagagaagaacactgcttcactattttttat
ggtacccagtttgtcctcaataccttaagtttagcagctgattctaaaggtgatgctgat
aaatggttgtgtggcttgaatatcttgtatcaagaggtcatgagagctcccacacctgca
atcacggagagctggctgagaaagcaaatctattctgttgatcagactagaagaaacagc
atcagtcttagagagctgaaagctgtccttccccaagtaaacttcaaagtgagcagcatg
aagttcttgaaggataaatttgcggaaataggtgctcacaaggaagagcttagttttgaa
caatttcatttgttctacaaaaagatcatgtttgaacaacagaaatcgattctcgatgaa
ttcaagaaggattcctctgtgttcattcttggaaatactgaccgtccagatgcttcagca
gttcatctccatgactttcagaggtttctcctacatgagcagcaggaatcttgggcacaa
gatctgagtaaagtccgagaacgaatgactgagtttgttgatgacactatgagagaaact
gctgaacccttcctctttgttgatgagttcctcacttacctttttgcaaaagaaaacagt
atttgggatgagaaatatgatacaatagatgtgcaggacatgaataatcctttgtcccac
tactggatttcttcctctcataacacatatctgacaggagaccagcttcgaagtgaatcc
tccacagaagcttacatcaggtgtcttaggatgggatgccgatgtattgagttggactgc
tgggatggtcctgatgggaagcccatcatttaccatggatggacacggacaacaaagatc
aaatttgatgatgtagtgcaggcaatcaaagatcacgcttttgttacatctgagtaccca
gtcattctgtcaattgaagagcactgtagtgtagaacagcaacgacacatggccaaagtg
ttcaaggaggtatttggggatcagcttttaatgaaacctgttgaagctagtgcagatcag
ctgccatcaccaactcaactgaaagaaaaaatcatcatcaagcacaaaaaactggggcca
aagggagacattgatgtcaacctggaagacaagaaagaagaaaaaaaacaacaaggagaa
ctttacatgtgggatgcaatagaacagcaatggactcggcattactgtgctattgctgat
ggaaagctttcattcagtgatgtcatagaacagaatgctgatgaagattcatcgaaggag
gtaaaacgtactgaactgcacttaaaggagaaatggttccatggaaaaatgaaagagggg
agaacaactgctgagaagctgctccaagaatattgtgctgaaatgggtggcaaggatgga
acattcctagttagggagagcgaggctttccctaatgattgcaccttgtcattctggaga
tcaggtagagtccagcattgccgtatccgttcttcaagtgatggggacactgtgaaatac
tacctgacagacaatgtcacttttgatagcatctatgatctcattcaacactacaaggag
gtccacttgaggtgtgctgaatttgatctgcgtctcaccgatgctgtgcctaatcccagc
cctcatgaaaataaagattggtactatagcaacttgagtcgaggagaggcagaagacatg
ctgatgagaattcctcgagatggagcctttctaattagaaagagagatgagcctgattca
tttgccatgactttcagagctgaggggaaggtgaagcacttccgaattcagcaagaaggt
cgccattttgtgcttggaacgtcagcctactttgagagtttagtggagctggtaacatac
tatgagaagcaccctctgtacaggaaaatgaaattacgttaccctgtgactgaggagctg
ctggagcgctacagcacagaaaaagatattaactctctttatgatgtcaagatgtacgtg
gaacccagtgaaatcacccctacagtgcctcagagaacagtgaaagccttgtatgactac
agagccaaacgaagtgatgaattgagcttcagtcgcggagctctgattcataatgtcaca
aaggaaactggaggctggtggaaaggggattatggagaaaaagtccaacactattttcca
tctaattacgttgaagacctatcatctgataattctgctgagcttgaaagccagattatt
gaggacaatccattaggatctctgtgtcatggcatattggtactaaatacctacaatgtt
gtgaaaatgccacaagggaaacacaaaaagccttttgtcttcattttggaacctaagaat
ccagaagatccgtgtgttgaatttgcaactgataaagtagaagaactgtttgaatggtac
caaagtgtccgtgaaatcacatggaaaactgcagaagaggagaacaggaggaaatactgg
gaaaagaatcaattgattgctattgaattatctgatctggtaatctactgcaagccaaca
agcaaaaccaaggacaatttagaaaatcctgatttcaaagaaatacgttcctttgtggaa
accaaggcagaaagtattgttaagcaaaagccggttgagttgctgaaatacaacttgaag
ggactgacacgtgtctatcctaaaggacagagggttgactcatcaaactatgacccattt
cgcctctggctttgtggctctcagatggtggctcttaactttcagactccagataaatac
atgcaattgaaccatgccttgttttcacttaatggacacactggctatgttctgcagcca
gaaagcatgagaaatgaagagtatgacccaatgccaaatgaatcgaagaggaaattgcag
atgattatgacagtgagggttttaggtgctcgtcatctccctaagcttggtagaagcatt
gcgtgtccctttgtagaggtagaaatatgtggggctgagtatgataacaacaaattcaag
acaacagttgtgaatgacaatggtcttaatccagtttgggcaccctgtccggagcaagtg
aaatttgaaatttatgatccaaatctagcatttttgcgctttgttgtttatgaggaggat
atgttcagtgaccccaatttcttagcacatgccacttttcccatcaaaggaatcaaatca
ggttttaggtcagttcctctcaagaatggttacagtgaagacatagagctagcctcactt
ctgattcactgtgaaatgcagcaagttctggaatatgaagaagagctttattcttcgtgt
cggcaacttcggaagcgccaggaggagcttaataaccagctattcctttatgatacccat
atgaatttaaggaatcctaacagagatgcattattaagagaattcaacgtgaatgaacac
aaactacaaatgtgtcaagaaacgtgtaaccggagattaagggagaagaaagtcagtaac
agcaaattctactcttaa

DBGET integrated database retrieval system