KEGG   Gallus gallus (chicken): 415805Help
Entry
415805            CDS       T01006                                 

Gene name
PLCG2
Definition
phospholipase C, gamma 2 (phosphatidylinositol-specific)
Orthology
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    415805 (PLCG2)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    415805 (PLCG2)
   04370 VEGF signaling pathway
    415805 (PLCG2)
   04020 Calcium signaling pathway
    415805 (PLCG2)
   04070 Phosphatidylinositol signaling system
    415805 (PLCG2)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     415805 (PLCG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
11
AA seq 1378 aa AA seqDB search
MGTCRNWGESAFRFRFLSNLCVQGRHLRRPAAQEWFSCAHLKCPLPTCCTFACLQLFLSL
FYQMSVRLWELFCRRAAVLLLCTAVSSSSWSAASEETSTVKTIQVGLKKKPKKMPRKSVD
YGELPEYEKSQIKRTLELGTVMTVFSIKKSSLERRTIQVIMETRQVAWSKTADKIEGFLD
LMEIKEIRPGKNSKDFERCKAKHREEHCFTIFYGTQFVLNTLSLAADSKGDADKWLCGLN
ILYQEVMRAPTPAITESWLRKQIYSVDQTRRNSISLRELKAVLPQVNFKVSSMKFLKDKF
AEIGAHKEELSFEQFHLFYKKIMFEQQKSILDEFKKDSSVFILGNTDRPDASAVHLHDFQ
RFLLHEQQESWAQDLSKVRERMTEFVDDTMRETAEPFLFVDEFLTYLFAKENSIWDEKYD
TIDVQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDCWDGPDGK
PIIYHGWTRTTKIKFDDVVQAIKDHAFVTSEYPVILSIEEHCSVEQQRHMAKVFKEVFGD
QLLMKPVEASADQLPSPTQLKEKIIIKHKKLGPKGDIDVNLEDKKEEKKQQGELYMWDAI
EQQWTRHYCAIADGKLSFSDVIEQNADEDSSKEVKRTELHLKEKWFHGKMKEGRTTAEKL
LQEYCAEMGGKDGTFLVRESEAFPNDCTLSFWRSGRVQHCRIRSSSDGDTVKYYLTDNVT
FDSIYDLIQHYKEVHLRCAEFDLRLTDAVPNPSPHENKDWYYSNLSRGEAEDMLMRIPRD
GAFLIRKRDEPDSFAMTFRAEGKVKHFRIQQEGRHFVLGTSAYFESLVELVTYYEKHPLY
RKMKLRYPVTEELLERYSTEKDINSLYDVKMYVEPSEITPTVPQRTVKALYDYRAKRSDE
LSFSRGALIHNVTKETGGWWKGDYGEKVQHYFPSNYVEDLSSDNSAELESQIIEDNPLGS
LCHGILVLNTYNVVKMPQGKHKKPFVFILEPKNPEDPCVEFATDKVEELFEWYQSVREIT
WKTAEEENRRKYWEKNQLIAIELSDLVIYCKPTSKTKDNLENPDFKEIRSFVETKAESIV
KQKPVELLKYNLKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKYMQLNHAL
FSLNGHTGYVLQPESMRNEEYDPMPNESKRKLQMIMTVRVLGARHLPKLGRSIACPFVEV
EICGAEYDNNKFKTTVVNDNGLNPVWAPCPEQVKFEIYDPNLAFLRFVVYEEDMFSDPNF
LAHATFPIKGIKSGFRSVPLKNGYSEDIELASLLIHCEMQQVLEYEEELYSSCRQLRKRQ
EELNNQLFLYDTHMNLRNPNRDALLREFNVNEHKLQMCQETCNRRLREKKVSNSKFYS
NT seq 4137 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgtgtagaaactggggcgagtctgccttcagattccgctttttgagcaacctt
tgtgtgcagggaaggcacctgcggcgtcctgcggctcaggagtggttcagctgtgctcat
ctgaaatgtccgttgccaacctgctgtactttcgcctgcctgcagctctttctctctctg
ttctatcagatgtctgtacggctttgggaacttttctgtaggagagcagcggtgcttctg
ctttgcacagcggtgtcttctagctcatggtccgctgcttcagaggaaaccagcacagtg
aaaaccatacaagttggattgaaaaagaaacctaagaaaatgcctcgaaagagtgtagat
tatggagagctgccggagtatgagaaaagccagatcaaaaggacgttggagctgggaact
gttatgacagtattcagtattaagaagagtagtctagaaagaaggactattcaggttata
atggaaaccaggcaggtagcctggagcaagacagctgacaagatcgaaggtttcttggat
ctgatggaaatcaaagaaattcgcccaggaaagaattcaaaggactttgaacgatgcaaa
gcaaaacacagagaagaacactgcttcactattttttatggtacccagtttgtcctcaat
accttaagtttagcagctgattctaaaggtgatgctgataaatggttgtgtggcttgaat
atcttgtatcaagaggtcatgagagctcccacacctgcaatcacggagagctggctgaga
aagcaaatctattctgttgatcagactagaagaaacagcatcagtcttagagagctgaaa
gctgtccttccccaagtaaacttcaaagtgagcagcatgaagttcttgaaggataaattt
gcggaaataggtgctcacaaggaagagcttagttttgaacaatttcatttgttctacaaa
aagatcatgtttgaacaacagaaatcgattctcgatgaattcaagaaggattcctctgtg
ttcattcttggaaatactgaccgtccagatgcttcagcagttcatctccatgactttcag
aggtttctcctacatgagcagcaggaatcttgggcacaagatctgagtaaagtccgagaa
cgaatgactgagtttgttgatgacactatgagagaaactgctgaacccttcctctttgtt
gatgagttcctcacttacctttttgcaaaagaaaacagtatttgggatgagaaatatgat
acaatagatgtgcaggacatgaataatcctttgtcccactactggatttcttcctctcat
aacacatatctgacaggagaccagcttcgaagtgaatcctccacagaagcttacatcagg
tgtcttaggatgggatgccgatgtattgagttggactgctgggatggtcctgatgggaag
cccatcatttaccatggatggacacggacaacaaagatcaaatttgatgatgtagtgcag
gcaatcaaagatcacgcttttgttacatctgagtacccagtcattctgtcaattgaagag
cactgtagtgtagaacagcaacgacacatggccaaagtgttcaaggaggtatttggggat
cagcttttaatgaaacctgttgaagctagtgcagatcagctgccatcaccaactcaactg
aaagaaaaaatcatcatcaagcacaaaaaactggggccaaagggagacattgatgtcaac
ctggaagacaagaaagaagaaaaaaaacaacaaggagaactttacatgtgggatgcaata
gaacagcaatggactcggcattactgtgctattgctgatggaaagctttcattcagtgat
gtcatagaacagaatgctgatgaagattcatcgaaggaggtaaaacgtactgaactgcac
ttaaaggagaaatggttccatggaaaaatgaaagaggggagaacaactgctgagaagctg
ctccaagagtattgtgctgaaatgggtggcaaggatggaacattcctagttagggagagc
gaggctttccctaatgattgcaccttgtcattctggagatcaggtagagtccagcattgc
cgtatccgttcttcaagtgatggggacactgtgaaatactacctgacagacaatgtcact
tttgatagcatctatgatctcattcaacactacaaggaggtccacttgaggtgtgctgaa
tttgatctgcgtctcaccgatgctgtgcctaatcccagccctcatgaaaataaagattgg
tactatagcaacttgagtcgaggagaggcagaagacatgctgatgagaattcctcgagat
ggagcctttctaattagaaagagagatgagcctgattcatttgccatgactttcagagct
gaggggaaggtgaagcacttccgaattcagcaagaaggtcgccattttgtgcttggaacg
tcagcctactttgagagtttagtggagctggtaacatactatgagaagcaccctctgtac
aggaaaatgaaattacgttaccctgtgactgaggagctgctggagcgctacagcacagaa
aaagatattaactctctttatgatgtcaagatgtacgtggaacccagtgaaatcacccct
acagtgcctcagagaacagtgaaagccttgtatgactacagagccaaacgaagtgatgaa
ttgagcttcagtcgcggagctctgattcataatgtcacaaaggaaactggaggctggtgg
aaaggggattatggagaaaaagtccaacactattttccatctaattacgttgaagaccta
tcatctgataattctgctgagcttgaaagccagattattgaggacaatccattaggatct
ctgtgtcatggcatattggtactaaatacctacaatgttgtgaaaatgccacaagggaaa
cacaaaaagccttttgtcttcattttggaacctaagaatccagaagatccgtgtgttgaa
tttgcaactgataaagtagaagaactgtttgaatggtaccaaagtgtccgtgaaatcaca
tggaaaactgcagaagaggagaacaggaggaaatactgggaaaagaatcaattgattgct
attgaattatctgatctggtaatctactgcaagccaacaagcaaaaccaaggacaattta
gaaaatcctgatttcaaagaaatacgttcctttgtggaaaccaaggcagaaagtattgtt
aagcaaaagccggttgagttgctgaaatacaacttgaagggactgacacgtgtctatcct
aaaggacagagggttgactcatcaaactatgacccatttcgcctctggctttgtggctct
cagatggtggctcttaactttcagactccagataaatacatgcaattgaaccatgccttg
ttttcacttaatggacacactggctatgttctgcagccagaaagcatgagaaatgaagag
tatgacccaatgccaaatgaatcgaagaggaaattgcagatgattatgacagtgagggtt
ttaggtgctcgtcatctccctaagcttggtagaagcattgcgtgtccctttgtagaggta
gaaatatgtggggctgagtatgataacaacaaattcaagacaacagttgtgaatgacaat
ggtcttaatccagtttgggcaccctgtccggagcaagtgaaatttgaaatttatgatcca
aatctagcatttttgcgctttgttgtttatgaggaggatatgttcagtgaccccaatttc
ttagcacatgccacttttcccatcaaaggaatcaaatcaggttttaggtcagttcctctc
aagaatggttacagtgaagacatagagctagcctcactgctgattcactgtgaaatgcag
caagttctggaatatgaagaagagctttattcttcgtgtcggcaacttcggaagcgccag
gaggagcttaataaccagctattcctttatgatacccatatgaatttaaggaatcctaac
agagatgcattattaagagaattcaacgtgaatgaacacaaactacaaatgtgtcaagaa
acgtgtaaccggagattaagggagaagaaagtcagtaacagcaaattctactcttaa

DBGET integrated database retrieval system