KEGG   Gallus gallus (chicken): 416477Help
Entry
416477            CDS       T01006                                 

Gene name
CYP3A4, CYP3A80
Definition
(RefSeq) cytochrome P450 family 3 subfamily A member 4
  KO
K07424  cytochrome P450 family 3 subfamily A [EC:1.14.14.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00140  Steroid hormone biosynthesis
gga00591  Linoleic acid metabolism
gga00830  Retinol metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    416477 (CYP3A4)
   00591 Linoleic acid metabolism
    416477 (CYP3A4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    416477 (CYP3A4)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     416477 (CYP3A4)
Cytochrome P450 [BR:gga00199]
 Cytochrome P450, animal type
  CYP3 family
   416477 (CYP3A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 416477
NCBI-ProteinID: NP_001316437
CGNC: 50264
Ensembl: ENSGALG00000004436
UniProt: E1BVB6
Position
14
AA seq 510 aa AA seqDB search
MGLLPDLPPITWLLLAAFLGLLVLYGIWPYQTFKKLGIPGPRPLPFLGTFLRYRQGLLNF
DQMCFEKYGKIWGIYDGRQPVMAILDPVLIKTILVKECYSTFTNRRVFGLSGRLESALSM
AMDDQWKRIRTVLSPTFTSGKLKEMFPIIESYGDKLVKNIEKKVANEEFLDIKSIFGAYS
MDVVASTSFSVDIDSMSKPSDPFVTNIRKFLKFSFLNPLLIFIVLFPFMIPVLEKMNVTL
LPTKVMDFFDAVFMKMKKEREEGYHVDRVDFLQLMIDSQSSQDSSKSAREKDSYKSLSDE
EILAQALIFVFAGYETTSSTLSYISYHLAIHPDVQKRLQDEIDANLPNKAAPTYNVVMQM
EYLDMVVNESLRLHPPGGRIERICKKTVEFNGVTIPKDMVVMIPAYVLHRDPAYWPKPEE
FRPERFSKENGENIDPYTFLPFGAGPRNCIGMRFALLIVKVAMVVLLQNFSFKPCKDTPI
PLVLDTKGFMQPKKPIILKMVPRAHSDPQN
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgggactccttccagaccttccccccatcacttggctgctccttgctgcttttctgggc
ctcctggtgctctatgggatatggccctaccagaccttcaagaagctgggcattcccggc
ccacggcctctgccatttttgggaacattcctgaggtaccgacaggggctcctgaatttt
gatcagatgtgctttgaaaaatacggtaaaatctgggggatttatgatggcaggcagcct
gtgatggctattctggaccccgtcctcatcaaaaccatcttggtgaaggagtgctatagc
acttttaccaatcgcagggtctttggtctgagtgggagactggagtcagctcttagcatg
gctatggatgaccagtggaaaaggattcgcactgtgttgtccccaactttcaccagtggg
aagctgaaagagatgttccctatcattgagagctatggtgataaattagtgaagaacatt
gagaagaaagtggctaatgaagagttcctggacataaagagcatttttggagcttacagc
atggacgtggtggccagcacttctttcagcgtggatattgactccatgagcaaacccagc
gacccctttgtcaccaacattaggaaatttctcaaattcagtttcctaaacccattattg
atattcatagtgttgttccccttcatgatcccagtgctggaaaagatgaatgtgactctg
ttacctaccaaagtcatggacttctttgatgcagtcttcatgaagatgaagaaggaacgg
gaagaaggataccacgtggaccgagtggacttcctgcagctgatgattgactctcagagc
tcacaggacagctccaagtctgccagggagaaggactcgtacaaatcattaagtgatgag
gagattctggcccaggctcttatctttgtctttgctggctatgaaaccaccagctccacc
ctcagctacatctcctatcacctggctatacaccctgacgtgcagaagcgactccaggac
gagatcgatgcaaacttgcctaacaaggctgctcctacgtacaatgtagtcatgcagatg
gagtatctggacatggtggtgaatgaatccctgcggctgcacccccctggggggcggatt
gagcggatctgcaagaagacagtggagttcaatggggtgaccataccaaaggacatggta
gtcatgatcccagcctacgtgctgcaccgtgacccggcgtactggcccaagccagaggaa
ttcaggcctgagaggtttagtaaagaaaacggagagaacattgacccctacaccttcctg
ccgtttggggccggccccaggaactgcatcggaatgagatttgctctcctcatcgttaaa
gtggctatggttgtccttctgcaaaacttctcattcaaaccctgcaaagacactccgatc
cccctggttctggacacaaaaggtttcatgcagccaaagaagcctatcattttgaagatg
gtccctagagcccacagtgatccgcagaactga

DBGET integrated database retrieval system