KEGG   Gallus gallus (chicken): 416477Help
Entry
416477            CDS       T01006                                 

Gene name
CYP3A4, CYP3A80
Definition
cytochrome P450, family 3, subfamily A, polypeptide 4
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:gga00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:gga00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:gga00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
14
AA seq 540 aa AA seqDB search
MSTVTAASQIRSSYSEAQAAWEWCCQAVSAMGLLPDLPPITWLLLAAFLGLLVLYGIWPY
QTFKKLGIPGPRPLPFLGTFLRYRQGLLNFDQMCFEKYGKIWGIYDGRQPVMAILDPVLI
KTILVKECYSTFTNRRVFGLSGRLESALSMAMDDQWKRIRTVLSPTFTSGKLKEMFPIIE
SYGDKLVKNIEKKVANEEFLDIKSIFGAYSMDVVASTSFSVDIDSMSKPSDPFVTNIRKF
LKFSFLNPLLIFIVLFPFMIPVLEKMNVTLLPTKVMDFFDAVFMKMKKEREEGYHVDRVD
FLQLMIDSQSSQDSSKSAREKDSYKSLSDEEILAQALIFVFAGYETTSSTLSYISYHLAI
HPDVQKRLQDEIDANLPNKAAPTYNVVMQMEYLDMVVNESLRLHPPGGRIERICKKTVEF
NGVTIPKDMVVMIPAYVLHRDPAYWPKPEEFRPERFSKENGENIDPYTFLPFGAGPRNCI
GMRFALLIVKVAMVVLLQNFSFKPCKDTPIPLVLDTKGFMQPKKPIILKMVPRAHSDPQN
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagttacagctgcaagtcagataagaagctcatatagtgaggcccaagctgcg
tgggagtggtgctgtcaggctgtgagtgcaatgggactccttccagaccttccccccatc
acttggctgctccttgctgcttttctgggcctcctggtgctctatgggatatggccctac
cagaccttcaagaagctgggcattcccggcccacggcctctgccatttttgggaacattc
ctgaggtaccgacaggggctcctgaattttgatcagatgtgctttgaaaaatacggtaaa
atctgggggatttatgatggcaggcagcctgtgatggctattctggaccccgtcctcatc
aaaaccatcttggtgaaggagtgctatagcacttttaccaatcgcagggtctttggtctg
agtgggagactggagtcagctcttagcatggctatggatgaccagtggaaaaggattcgc
actgtgttgtccccaactttcaccagtgggaagctgaaagagatgttccctatcattgag
agctatggtgataaattagtgaagaacattgagaagaaagtggctaatgaagagttcctg
gacataaagagcatttttggagcttacagcatggacgtggtggccagcacttctttcagc
gtggatattgactccatgagcaaacccagcgacccctttgtcaccaacattaggaaattt
ctcaaattcagtttcctaaacccattattgatattcatagtgttgttccccttcatgatc
ccagtgctggaaaagatgaatgtgactctgttacctaccaaagtcatggacttctttgat
gcagtcttcatgaagatgaagaaggaacgggaagaaggataccacgtggaccgagtggac
ttcctgcagctgatgattgactctcagagctcacaggacagctccaagtctgccagggag
aaggactcgtacaaatcattaagtgatgaggagattctggcccaggctcttatctttgtc
tttgctggctatgaaaccaccagctccaccctcagctacatctcctatcacctggctata
caccctgacgtgcagaagcgactccaggacgagatcgatgcaaacttgcctaacaaggct
gctcctacgtacaatgtagtcatgcagatggagtatctggacatggtggtgaatgaatcc
ctgcggctgcacccccctggggggcggattgagcggatctgcaagaagacagtggagttc
aatggggtgaccataccaaaggacatggtagtcatgatcccagcctacgtgctgcaccgt
gacccggcgtactggcccaagccagaggaattcaggcctgagaggtttagtaaagaaaac
ggagagaacattgacccctacaccttcctgccgtttggggccggccccaggaactgcatc
ggaatgagatttgctctcctcatcgttaaagtggctatggttgtccttctgcaaaacttc
tcattcaaaccctgcaaagacactccgatccccctggttctggacacaaaaggtttcatg
cagccaaagaagcctatcattttgaagatggtccctagagcccacagtgatccgcagaac
tga

DBGET integrated database retrieval system