KEGG   Gallus gallus (chicken): 419444Help
Entry
419444            CDS       T01006                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00562  Inositol phosphate metabolism
gga04012  ErbB signaling pathway
gga04068  FoxO signaling pathway
gga04070  Phosphatidylinositol signaling system
gga04140  Autophagy - animal
gga04150  mTOR signaling pathway
gga04210  Apoptosis
gga04218  Cellular senescence
gga04370  VEGF signaling pathway
gga04510  Focal adhesion
gga04620  Toll-like receptor signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04810  Regulation of actin cytoskeleton
gga04910  Insulin signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04933  AGE-RAGE signaling pathway in diabetic complications
gga05164  Influenza A
Module
gga_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    419444 (PIK3CD)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    419444 (PIK3CD)
   04370 VEGF signaling pathway
    419444 (PIK3CD)
   04068 FoxO signaling pathway
    419444 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    419444 (PIK3CD)
   04150 mTOR signaling pathway
    419444 (PIK3CD)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    419444 (PIK3CD)
  Cell growth and death
   04210 Apoptosis
    419444 (PIK3CD)
   04218 Cellular senescence
    419444 (PIK3CD)
  Cellular community - eukaryotes
   04510 Focal adhesion
    419444 (PIK3CD)
  Cell motility
   04810 Regulation of actin cytoskeleton
    419444 (PIK3CD)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    419444 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    419444 (PIK3CD)
  Endocrine system
   04910 Insulin signaling pathway
    419444 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    419444 (PIK3CD)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    419444 (PIK3CD)
  Infectious diseases
   05164 Influenza A
    419444 (PIK3CD)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     419444 (PIK3CD)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    419444 (PIK3CD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 419444
NCBI-ProteinID: NP_001012714
CGNC: 1859
Ensembl: ENSGALG00000002583
UniProt: Q5F3P4
Position
21
AA seq 1046 aa AA seqDB search
MPRGIYCPMEFWSKGENQNIQVDFLLPTGIYLNLSVPCNASLDTIKQVVWKHAQYEPLYH
MLSDPEAYVFTCINQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSVQDPEVNDFRTKMCQFCEERAAKRQQLSWAAWMEYNFPLQLEPMAKGLGT
GLLHTPIKNIFVNVKFQSGGESFTFQISPNEFPITLMSYAVKKQATVFRHETMENPEDYT
LQVNGKYEYLYGNYPLYQFQYIRSCLHRGLTPHLTMVHSSTIIAMRDEQVNSIANPPKMA
VKPPPLPKKKPNYGSLWSLEQSFYIELVQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVNMCSEPVWKQRLDFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
VNVMLFDYKDQLKTGECCLHMWSSFPDEKGELLNPMGTVQCNPNTESAAALVICFPNVAS
HPVYYPSFEQLLELGRNGEQPRSAPEDPEEKLQLKEILERRNHTELYEHEKDLVWKMRYD
IRDQYPQALAKLLTITKWNKHEDVAQMISLLQTWPELPVLNALELLDFSFPDRYVGSFAI
NSLKKLTDHELFQYLLQLVQVLKYESYLDCELTKFLLDRALSNRKIGHFLFWHLRSEMHV
PAVALRFGLILEAYCRGSTHHMKVLMKQGEALSKMKALNEFVKLSSPKATKPQAKEMMHV
CMKQETYLEALSHLQSPLNPSIILTEVCVDQCTFMDSKMKPLWIVFNNEETGGGGVGIIF
KNGGDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDKTGLIEVVMHSDTIANIQ
LNKSNMAATAAFNKDALLNWLKSKNPGDALEQAIEEFTLSCAGYCVATYVLGIGDRHSDN
IMIRETGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRG
YCEKAYMILRRHGPLFLHLFALMKAAGLPELTCSKDIQYLKDSLALGKTDEEALKHFRLK
FNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgccccggggcatttattgccctatggaattctggtccaagggggaaaaccaaaacatc
caggtggactttctgctgccaacaggcatatacttgaacctctccgtgccctgcaatgcc
agcttggacaccatcaaacaggtggtgtggaagcacgctcagtatgagcccctctaccac
atgctcagtgatcccgaggcctacgtcttcacgtgcatcaaccagacagcagagcagcaa
gagctggaggatgagcagcggcgcctttgtgacatccaacccttcctgcccgtactgcgg
ctcgtggctcgagaaggtgacagagtcaagaagcttattaactcccaaatcagcctgctc
attgggaaaggtttgcacgagtttgactctgtgcaggatccagaggtgaacgatttccgc
accaaaatgtgccagttctgtgaggagagagcagcaaagcggcagcagctcagctgggca
gcttggatggagtacaactttcccttgcagcttgagcccatggccaaaggccttggaact
ggactcttgcacacacccatcaagaacatttttgtcaacgtcaagtttcagtctggcggg
gagagcttcactttccagatctccccaaatgaattccctatcacattaatgagctatgct
gtcaagaagcaggctactgtcttccgccatgagacaatggagaacccagaggactacaca
ctgcaggtgaatgggaagtacgaatatctctatgggaactaccccctgtaccagttccag
tacattcgcagctgcctgcaccgaggcttaacaccccacctgactatggtccactcatcc
actattattgctatgagagatgagcaggtcaacagtattgccaaccccccaaagatggca
gtgaaacctcccccactccctaagaaaaagccaaactatggttctctctggtccttggag
cagtctttctacattgagctagtgcaaggcagcaaggtcaatgcagatgagagaatgaag
ctggtggtgcaggcaggtctctttcacggcaatgagatgctgtgcaaaacggtgtcaagc
tctgaagtgaacatgtgctcagagccagtgtggaagcagaggctggactttgatattaac
atctgtgatcttcctcgtatggcacggctctgctttgcactctatgctgtcatcgagaag
gcgaagaaagcacgctccaccaagaagaagtccaagaaagctgactgccccattgcctgg
gtgaatgtcatgctctttgattataaggaccagctgaaaacaggggagtgctgcttgcat
atgtggtcctccttcccagatgagaaaggtgaacttctgaaccccatgggcacagtgcaa
tgcaaccccaacacagaaagtgcagcagccttagtcatctgcttccccaacgttgcatcg
catcctgtgtattatccatcatttgagcagctgctggaattggggaggaatggagaacaa
ccccgctctgcaccagaagatccagaggagaagctgcaactgaaggaaatactggagcgg
aggaaccacactgagctctatgagcatgagaaagatctggtgtggaagatgagatatgat
atccgtgaccaatatccacaagctttggcaaagctccttaccatcaccaaatggaacaag
catgaagacgtggcccagatgatttccctgcttcagacctggccagagttgcctgtcctg
aatgccttagagctgttggattttagcttccctgaccgttatgttggctcctttgctatc
aactcattaaagaagctgacagatcatgaattgttccaatatctgctgcagctggtccag
gtgctcaagtatgaatcctacttagactgtgaattaaccaagttcctgctggacagggcg
ctatccaaccgtaagatcggccacttcctattctggcacctcaggtcagaaatgcacgtc
cctgcagtcgccttgaggtttggcttgatcctggaagcgtactgcaggggcagcacccac
catatgaaggttttgatgaaacagggagaagcactcagcaagatgaaggctctgaatgag
tttgttaaattgagctctccaaaggccaccaagcctcaagccaaggagatgatgcatgtg
tgcatgaagcaggaaacttacctcgaagcactttcccacctccagtcccctctgaacccc
agcattatcctcactgaagtttgtgtggatcagtgcacgtttatggattccaaaatgaaa
cccttatggattgtttttaataatgaagagacaggtggaggtggagtgggtatcattttt
aaaaatggaggtgatctgcgccaggacatgctgactctgcagatgatccaactgatggac
gttctgtggaagcaggagggcctggacctgaggatgactccttatggctgcctctccaca
ggagacaagactgggctgatagaagtagtcatgcattctgataccatcgctaacatccag
ctgaacaagagcaacatggctgccactgcagccttcaacaaggatgcactgctaaactgg
ctgaaatccaagaacccaggggatgcgttagaacaagctatagaggagttcactctttcc
tgtgcagggtactgcgtggcaacatacgtgctggggataggtgaccggcacagcgataac
atcatgatccgggaaaccggccagctgttccatattgattttggtcactttttggggaac
ttcaagaccaaatttggtattaatagagaacgagttcctttcatcttaacctacgatttt
gtgcacgtcatccagcaaggaaaaacaaacaacagtgagaagtttgaaagattcaggggt
tattgtgaaaaagcttacatgattctgaggcgccacggtcctctcttcctgcacctgttt
gcactgatgaaagctgctggcctgccagagctcacctgctctaaagacattcagtacctt
aaggattccctggctctgggtaaaacagatgaagaggcactgaaacacttcagactcaag
tttaatgaagccctacgagagagctggaaaaccaaagtgaactggctggcacacaatgta
tccaaagataacagacagtag

DBGET integrated database retrieval system