KEGG   Gallus gallus (chicken): 419444Help
Entry
419444            CDS       T01006                                 

Gene name
PIK3CD
Definition
phosphoinositide-3-kinase, catalytic, delta polypeptide (EC:2.7.1.153)
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
gga  Gallus gallus (chicken)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Influenza A
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:gga00562]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:gga04012]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:gga04370]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:gga04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:gga04068]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:gga04070]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:gga04150]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:gga04810]
Cellular Processes; Cell growth and death; Apoptosis [PATH:gga04210]
Cellular Processes; Cell communication; Focal adhesion [PATH:gga04510]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:gga04620]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:gga04910]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:gga04914]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:gga04261]
Human Diseases; Infectious diseases; Influenza A [PATH:gga05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
21
AA seq 1046 aa AA seqDB search
MPRGIYCPMEFWSKGENQNIQVDFLLPTGIYLNLSVPCNASLDTIKQVVWKHAQYEPLYH
MLSDPEAYVFTCINQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSVQDPEVNDFRTKMCQFCEERAAKRQQLSWAAWMEYNFPLQLEPMAKGLGT
GLLHTPIKNIFVNVKFQSGGESFTFQISPNEFPITLMSYAVKKQATVFRHETMENPEDYT
LQVNGKYEYLYGNYPLYQFQYIRSCLHRGLTPHLTMVHSSTIIAMRDEQVNSIANPPKMA
VKPPPLPKKKPNYGSLWSLEQSFYIELVQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVNMCSEPVWKQRLDFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
VNVMLFDYKDQLKTGECCLHMWSSFPDEKGELLNPMGTVQCNPNTESAAALVICFPNVAS
HPVYYPSFEQLLELGRNGEQPRSAPEDPEEKLQLKEILERRNHTELYEHEKDLVWKMRYD
IRDQYPQALAKLLTITKWNKHEDVAQMISLLQTWPELPVLNALELLDFSFPDRYVGSFAI
NSLKKLTDHELFQYLLQLVQVLKYESYLDCELTKFLLDRALSNRKIGHFLFWHLRSEMHV
PAVALRFGLILEAYCRGSTHHMKVLMKQGEALSKMKALNEFVKLSSPKATKPQAKEMMHV
CMKQETYLEALSHLQSPLNPSIILTEVCVDQCTFMDSKMKPLWIVFNNEETGGGGVGIIF
KNGGDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDKTGLIEVVMHSDTIANIQ
LNKSNMAATAAFNKDALLNWLKSKNPGDALEQAIEEFTLSCAGYCVATYVLGIGDRHSDN
IMIRETGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRG
YCEKAYMILRRHGPLFLHLFALMKAAGLPELTCSKDIQYLKDSLALGKTDEEALKHFRLK
FNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgccccggggcatttattgccctatggaattctggtccaagggggaaaaccaaaacatc
caggtggactttctgctgccaacaggcatatacttgaacctctccgtgccctgcaatgcc
agcttggacaccatcaaacaggtggtgtggaagcacgctcagtatgagcccctctaccac
atgctcagtgatcccgaggcctacgtcttcacgtgcatcaaccagacagcagagcagcaa
gagctggaggatgagcagcggcgcctttgtgacatccaacccttcctgcccgtactgcgg
ctcgtggctcgagaaggtgacagagtcaagaagcttattaactcccaaatcagcctgctc
attgggaaaggtttgcacgagtttgactctgtgcaggatccagaggtgaacgatttccgc
accaaaatgtgccagttctgtgaggagagagcagcaaagcggcagcagctcagctgggca
gcttggatggagtacaactttcccttgcagcttgagcccatggccaaaggccttggaact
ggactcttgcacacacccatcaagaacatttttgtcaacgtcaagtttcagtctggcggg
gagagcttcactttccagatctccccaaatgaattccctatcacattaatgagctatgct
gtcaagaagcaggctactgtcttccgccatgagacaatggagaacccagaggactacaca
ctgcaggtgaatgggaagtacgaatatctctatgggaactaccccctgtaccagttccag
tacattcgcagctgcctgcaccgaggcttaacaccccacctgactatggtccactcatcc
actattattgctatgagagatgagcaggtcaacagtattgccaaccccccaaagatggca
gtgaaacctcccccactccctaagaaaaagccaaactatggttctctctggtccttggag
cagtctttctacattgagctagtgcaaggcagcaaggtcaatgcagatgagagaatgaag
ctggtggtgcaggcaggtctctttcacggcaatgagatgctgtgcaaaacggtgtcaagc
tctgaagtgaacatgtgctcagagccagtgtggaagcagaggctggactttgatattaac
atctgtgatcttcctcgtatggcacggctctgctttgcactctatgctgtcatcgagaag
gcgaagaaagcacgctccaccaagaagaagtccaagaaagctgactgccccattgcctgg
gtgaatgtcatgctctttgattataaggaccagctgaaaacaggggagtgctgcttgcat
atgtggtcctccttcccagatgagaaaggtgaacttctgaaccccatgggcacagtgcaa
tgcaaccccaacacagaaagtgcagcagccttagtcatctgcttccccaacgttgcatcg
catcctgtgtattatccatcatttgagcagctgctggaattggggaggaatggagaacaa
ccccgctctgcaccagaagatccagaggagaagctgcaactgaaggaaatactggagcgg
aggaaccacactgagctctatgagcatgagaaagatctggtgtggaagatgagatatgat
atccgtgaccaatatccacaagctttggcaaagctccttaccatcaccaaatggaacaag
catgaagacgtggcccagatgatttccctgcttcagacctggccagagttgcctgtcctg
aatgccttagagctgttggattttagcttccctgaccgttatgttggctcctttgctatc
aactcattaaagaagctgacagatcatgaattgttccaatatctgctgcagctggtccag
gtgctcaagtatgaatcctacttagactgtgaattaaccaagttcctgctggacagggcg
ctatccaaccgtaagatcggccacttcctattctggcacctcaggtcagaaatgcacgtc
cctgcagtcgccttgaggtttggcttgatcctggaagcgtactgcaggggcagcacccac
catatgaaggttttgatgaaacagggagaagcactcagcaagatgaaggctctgaatgag
tttgttaaattgagctctccaaaggccaccaagcctcaagccaaggagatgatgcatgtg
tgcatgaagcaggaaacttacctcgaagcactttcccacctccagtcccctctgaacccc
agcattatcctcactgaagtttgtgtggatcagtgcacgtttatggattccaaaatgaaa
cccttatggattgtttttaataatgaagagacaggtggaggtggagtgggtatcattttt
aaaaatggaggtgatctgcgccaggacatgctgactctgcagatgatccaactgatggac
gttctgtggaagcaggagggcctggacctgaggatgactccttatggctgcctctccaca
ggagacaagactgggctgatagaagtagtcatgcattctgataccatcgctaacatccag
ctgaacaagagcaacatggctgccactgcagccttcaacaaggatgcactgctaaactgg
ctgaaatccaagaacccaggggatgcgttagaacaagctatagaggagttcactctttcc
tgtgcagggtactgcgtggcaacatacgtgctggggataggtgaccggcacagcgataac
atcatgatccgggaaaccggccagctgttccatattgattttggtcactttttggggaac
ttcaagaccaaatttggtattaatagagaacgagttcctttcatcttaacctacgatttt
gtgcacgtcatccagcaaggaaaaacaaacaacagtgagaagtttgaaagattcaggggt
tattgtgaaaaagcttacatgattctgaggcgccacggtcctctcttcctgcacctgttt
gcactgatgaaagctgctggcctgccagagctcacctgctctaaagacattcagtacctt
aaggattccctggctctgggtaaaacagatgaagaggcactgaaacacttcagactcaag
tttaatgaagccctacgagagagctggaaaaccaaagtgaactggctggcacacaatgta
tccaaagataacagacagtag

DBGET integrated database retrieval system