KEGG   Gallus gallus (chicken): 424729Help
Entry
424729            CDS       T01006                                 

Gene name
CYP2J19, CYP2J2L1
Definition
(RefSeq) cytochrome P450, family 2, subfamily J, polypeptide 19
  KO
K07418  cytochrome P450 family 2 subfamily J [EC:1.14.14.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00590  Arachidonic acid metabolism
gga00591  Linoleic acid metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    424729 (CYP2J19)
   00591 Linoleic acid metabolism
    424729 (CYP2J19)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     424729 (CYP2J19)
Cytochrome P450 [BR:gga00199]
 Cytochrome P450, animal type
  CYP2 family
   424729 (CYP2J19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 424729
NCBI-ProteinID: XP_422553
CGNC: 52243
Position
8
AA seq 496 aa AA seqDB search
MDFRFWPISQLGKLNVSMLLVVLVMFLLIIDFVRKRRPRNFPPGPQLFPLVGTIVDLRQP
LHLEMQKLTARYGNIFSVQFGGLTFVVVSGYQMVREALVHQAEIFADRPHIPLLQEIFRG
FGLISSNGHIWRQQRKFVSATLKSIAVSFESKVQEESRYLVEAMEEEKGQPFDPHYKINS
AVSNIICSITFGNRFNYHDSNFQELLHLLAETLLLIGSFWGQLYNAFPLIMRWLPGPFRK
IFRHWEKLQRFVRGVIAKHKEDLDQSDLGDYIDCYLKEIEKCKGDTNSYFHEENLLCSTL
DLFLTGTETTATAIRWALLYMAAYPHIQEKVQLEIDAVIGQCRQPTMEDKEHMPYTSAVL
SEVLRMGNIVPLGVPRMSTNDTTLAGFHVPKGTTLMTSLTSIMFDKNVWETPDTFNPEHF
LENGQYRRREAFLPFSAGKRACPGEQLARTELFIFFTALLQKFTFQAPSATVLSFAFTLS
LTRCPKPFQLCALPRC
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggattttcgcttttggcccatttcccaattgggaaagctgaacgtttcgatgctcttg
gtggttcttgtcatgtttcttttgattattgactttgtgagaaagagacgtcccaggaat
ttccctcctgggccacagctatttcctcttgtgggaaccattgtggatttaaggcaacct
ctccatctggagatgcagaagcttactgcgaggtatggaaacatcttcagcgtgcagttt
ggaggtctgacttttgtggtggtcagtgggtaccagatggtgagagaagcccttgtccac
caggctgaaatatttgcagatcgaccacatattccacttctccaagaaatttttagaggc
tttggtctcatatcctcaaatggtcacatatggaggcaacagagaaagtttgtttcagca
acgctgaaaagcattgcggtcagttttgagtcaaaagtgcaagaggagagccggtacctc
gtggaggcgatggaggaagagaaggggcaaccgtttgaccctcattacaaaattaatagc
gctgtttcgaacattatctgttctataacttttgggaaccgcttcaactaccatgacagc
aacttccaggaattactgcacttgcttgcagaaacactgctgctgataggaagtttctgg
ggccagctgtataatgctttccctctgataatgagatggctaccagggcccttcaggaag
atattcaggcactgggagaaactgcagcgttttgtgaggggagtgattgcaaaacacaag
gaggacttggaccagtctgacttgggagattacattgactgttacttaaaggaaatagaa
aagtgtaagggtgacaccaactcctatttccatgaggaaaatctgctctgctccacactg
gacctcttcttgactgggacagagacaacagcaaccgccatccgctgggctctgctctac
atggccgcgtacccccacattcaggagaaagtgcagcttgaaattgatgctgtgattggc
cagtgccgccagcccaccatggaggacaaggagcacatgccctacaccagcgcagtgctg
agcgaggtgctgcgaatgggcaacattgtgccgttgggagtgcccaggatgtccaccaat
gacacaaccctggctggcttccacgtgcccaagggtaccacgctgatgaccagcctgact
tcaataatgtttgacaaaaatgtgtgggagactccagacacctttaatcctgaacacttc
ctggagaacggccagtacaggaggcgggaggctttcctgcccttctctgcaggcaagcgt
gcctgtcctggtgagcagctggccaggactgagctcttcatcttcttcactgccctgctg
cagaagttcaccttccaggctccatctgccaccgtgctgagctttgccttcacgctcagc
ctcacgcgctgccccaagcccttccagctctgcgccctgcctcgctgctga

DBGET integrated database retrieval system