KEGG   Gallus gallus (chicken): 424941Help
Entry
424941            CDS       T01006                                 

Gene name
EIF4E2
Definition
(RefSeq) eukaryotic translation initiation factor 4E family member 2
  KO
K03259  translation initiation factor 4E
Organism
gga  Gallus gallus (chicken)
Pathway
gga03013  RNA transport
gga04150  mTOR signaling pathway
gga04910  Insulin signaling pathway
Module
gga_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    424941 (EIF4E2)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    424941 (EIF4E2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    424941 (EIF4E2)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     424941 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     424941 (EIF4E2)
Translation factors [BR:gga03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    424941 (EIF4E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E Stm1_N
Motif
Other DBs
NCBI-GeneID: 424941
NCBI-ProteinID: XP_003641810
CGNC: 52295
Ensembl: ENSGALG00000007919
UniProt: A0A1D5NWQ5
Position
9
AA seq 236 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENNTQKDSEKEKNDREKPQSTTKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKAWEEFHGLVNSSGR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaattcgacgcattgaaagatgatgatagtggagaccatgaccagaatgag
gagaataacacacagaaagacagtgagaaggaaaagaatgatcgagagaaaccacagagt
accaccaagaggaaggcagttgtcccaggaccagctgagcaccccttgcagtataattac
actttctggtactccagacgaacacctgggaggcctaccagctcgcagagttatgaacag
aacatcaaacagattggcacctttgcctcagtggagcagttctggcggttttacagtcac
atggtacgtcctggggacctgacaggccatagtgacttccatcttttcaaagagggcatc
aaacccatgtgggaggatgatgccaacaaaaatggtggtaaatggattatccgtctgcgg
aagggcttagcatcacgatgttgggagaatctcattctggcgatgcttggagagcagttc
atggtgggcgaagaaatctgtggggcggtcgtctctgtccgattccaggaggatattatc
tcgatatggaacaagacagccagcgaccaggccacgacagcccggatacgcgacacgtta
cgaagagtgctcaacctacctcccaacaccatcatggaatataaaacacacaccgatagc
atcaaggcctgggaggagtttcatggcctggtgaacagcagtggccgctga

DBGET integrated database retrieval system