KEGG   Gallus gallus (chicken): 424941Help
Entry
424941            CDS       T01006                                 

Gene name
EIF4E2
Definition
eukaryotic translation initiation factor 4E family member 2
Orthology
K03259  
translation initiation factor 4E
Organism
gga  Gallus gallus (chicken)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:gga03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:gga04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:gga04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
9
AA seq 236 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENNTQKDSEKEKNDREKPQSTTKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKAWEEFHGLVNSSGR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaattcgacgcattgaaagatgatgatagtggagaccatgaccagaatgag
gagaataacacacagaaagacagtgagaaggaaaagaatgatcgagagaaaccacagagt
accaccaagaggaaggcagttgtcccaggaccagctgagcaccccttgcagtataattac
actttctggtactccagacgaacacctgggaggcctaccagctcgcagagttatgaacag
aacatcaaacagattggcacctttgcctcagtggagcagttctggcggttttacagtcac
atggtacgtcctggggacctgacaggccatagtgacttccatcttttcaaagagggcatc
aaacccatgtgggaggatgatgccaacaaaaatggtggtaaatggattatccgtctgcgg
aagggcttagcatcacgatgttgggagaatctcattctggcgatgcttggagagcagttc
atggtgggcgaagaaatctgtggggcggtcgtctctgtccgattccaggaggatattatc
tcgatatggaacaagacagccagcgaccaggccacgacagcccggatacgcgacacgtta
cgaagagtgctcaacctacctcccaacaccatcatggaatataaaacacacaccgatagc
atcaaggcctgggaggagtttcatggcctggtgaacagcagtggccgctga

DBGET integrated database retrieval system