KEGG   Gallus gallus (chicken): 424941Help
Entry
424941            CDS       T01006                                 

Gene name
EIF4E2
Definition
eukaryotic translation initiation factor 4E family member 2
Orthology
K03259  
translation initiation factor 4E
Organism
gga  Gallus gallus (chicken)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    424941 (EIF4E2)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    424941 (EIF4E2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    424941 (EIF4E2)
Translation factors [BR:gga03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    424941 (EIF4E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
9
AA seq 236 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENNTQKDSEKEKNDREKPQSTTKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKAWEEFHGLVNSSGR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaattcgacgcattgaaagatgatgatagtggagaccatgaccagaatgag
gagaataacacacagaaagacagtgagaaggaaaagaatgatcgagagaaaccacagagt
accaccaagaggaaggcagttgtcccaggaccagctgagcaccccttgcagtataattac
actttctggtactccagacgaacacctgggaggcctaccagctcgcagagttatgaacag
aacatcaaacagattggcacctttgcctcagtggagcagttctggcggttttacagtcac
atggtacgtcctggggacctgacaggccatagtgacttccatcttttcaaagagggcatc
aaacccatgtgggaggatgatgccaacaaaaatggtggtaaatggattatccgtctgcgg
aagggcttagcatcacgatgttgggagaatctcattctggcgatgcttggagagcagttc
atggtgggcgaagaaatctgtggggcggtcgtctctgtccgattccaggaggatattatc
tcgatatggaacaagacagccagcgaccaggccacgacagcccggatacgcgacacgtta
cgaagagtgctcaacctacctcccaacaccatcatggaatataaaacacacaccgatagc
atcaaggcctgggaggagtttcatggcctggtgaacagcagtggccgctga

DBGET integrated database retrieval system