KEGG   Gallus gallus (chicken): 428246Help
Entry
428246            CDS       T01006                                 

Gene name
USP28
Definition
ubiquitin specific peptidase 28 (EC:3.4.19.12)
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     428246 (USP28)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   428246 (USP28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
24
AA seq 1047 aa AA seqDB search
MTAELQAASGGPGGLEADCQVLNKMKEITGIQDADFLHAALKAAKGNLMEALIVLTEERD
QEPVQNTAAAEPSSWEGSAVGKEPPQGGAAFDPEKKGDVHSAVAYGQLESPKAHAAERPQ
EVHSPEHKNRSKRKRCEVWGENSKQSDWKRVGDWPVGMKNIGNTCWFSAVIQSLFQLPQF
RRLVLSYSFPPNVLESCRTRTGKRNIAFMQELQCLFALMLGTRRKFVDPSAALELLRDAF
KSTEEQQQDVSEFTHKLLDWLEDAFQLAVNVRSPGDKSENPMVQLFYGTFLTEGVHEGNT
FSKIETFGQYPLQVNGYRNLNECLEGAMVEGEMDEETATQSVKYVQERWFTKLPPVLTFE
LSRFEFNQSLGQPEKIHTKLEFPQTIFMDRYLYCSKELIQTKREEMKKLKEKMLVLQQKL
ERYMKYGSGPARFPLPDMLQYVLEFITTKPAGAVSSACVSSTEDSQMMDRQSQGESLILG
TPSQPDSMLDGKDGKPEDEAVLLANSSPQQQLNAPLQPSEPPAEMSDCPAPHVVSEEEMN
LVTTCLQRWRNEIEQDVRDLKESIARVSLSIDEMYSDPHLQQVPYHLHAVLVHEGQANAG
HYWAFIYDQPRKSWLKYNDISVTESSWEELERDSFGGLRNASAYCLMYISDKVSHVVAGE
GDGSEVGQFQKEVEALPPELRRYIQEDNWRLEQEAEEWEEEQSCKIPSTASESQELSPES
GLDPPAAHEQSLRSLSSEHAMIAKEQTAKAIANAANVYEKNGVEAALCEAFHEEYSRLYL
LSKETPTPQNDARLQHVLVYFLQNDAPQQIVERTLLEQFADKNLSYDERSISIMKVARDK
LKEIGPDEVNMEEYKKWHEDYSLFRKVSVYLLTGLELYQNRKYKESLTYLIYAYQSNTTL
LKKGANRGVNESLITLYRRKCLLKLNEVASSLFVSCEEAHVAEGISILNELIIPCMHLIN
NFDISREDMDAIEVMRNRWCSYLGREDMDASLQIRLGELLPRLLDGSTEVVVLKEPPKIR
PNSPYDLCSRFAAVMESIHDASTVTVK
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgagctgcaggccgcgagcggcggccccggcggcctcgaggcggattgccag
gttttaaacaagatgaaagagataacaggaattcaggatgcagacttccttcacgctgct
ctcaaggctgctaagggaaacctgatggaggcactcatcgtcctcacagaggagcgtgat
caggagcctgttcagaacacagctgctgcagagccgtcctcttgggaaggcagtgcagtg
ggcaaagagcccccacaaggtggtgctgcgttcgaccctgaaaagaaaggagatgtgcac
tcagctgttgcctacggacagctggaatcaccaaaagctcatgctgctgaaagaccacag
gaggtccattctcctgaacacaaaaaccgctccaaaaggaaacgctgtgaagtctgggga
gagaattccaaacagagcgactggaagagagtgggcgattggcctgtggggatgaagaac
atcggcaacacgtgttggtttagtgctgtcatacagtctcttttccagttgccgcagttc
cggaggttggtgctcagctactccttcccaccaaacgtacttgagagctgccggacgcgc
actggaaaaagaaatattgcattcatgcaagagcttcagtgtctgtttgctttaatgctg
ggaacacgtcggaagtttgtggacccttctgcagcactggaactcttaagggatgcgttt
aaatcaaccgaggagcagcagcaagatgtgagtgagttcacacacaaactgctggattgg
ctggaagatgcattccagctcgctgtgaatgtcagaagccctggggacaaatccgaaaac
ccaatggtccaacttttctatgggactttcttgactgagggggtccacgagggcaatact
ttttccaagatcgaaacctttggtcagtatccccttcaggtaaatggttatcgaaacttg
aatgagtgcttggaaggagccatggtggagggagagatggatgaggagacagcaactcag
tcagtgaaatatgtacaggagcgctggttcaccaaactccctcctgtgctgacctttgaa
ctctcccgatttgagttcaaccaatccctgggacagccagagaaaatccacacaaagctg
gagttccctcagactattttcatggacaggtacctctactgcagcaaagagcttattcag
acaaagagagaagaaatgaagaaattgaaggagaagatgctggttctgcaacagaaactg
gaaaggtatatgaagtacggctctggcccagcacgcttcccactgcctgacatgctgcaa
tatgttctggaattcatcactacaaagcctgctggagctgtgtcctctgcgtgcgtgtct
tctactgaggactctcagatgatggacaggcagtcccagggcgagtcgctcattctgggc
acgccttcacagcctgacagcatgctagatggaaaggatggtaagcctgaagatgaagct
gtcctattggcaaattcctcacctcagcaacaactgaacgcgcctctgcagccttctgaa
ccaccagcagagatgtcagactgtcctgctccccacgtggtttctgaggaagagatgaac
ctggttacgacgtgtctgcagcgatggaggaatgagattgagcaagatgtgcgagatctg
aaggagtccattgccagagtcagcctatccattgacgaaatgtacagcgaccctcacctc
cagcaggttccttatcacttgcacgctgtcttggtgcatgaagggcaagcaaatgctggt
cactactgggccttcatatatgaccagcctcggaaaagctggctgaaatacaatgacatc
tcagtgacagaatcatcgtgggaagagctggagagagattcatttggtggcctgaggaac
gccagtgcttactgcctgatgtacataagcgataaggtgtcccacgttgttgcaggtgaa
ggtgacggctcagaggtcgggcagttccagaaggaggtggaggctttgcccccagagctg
aggcgttacatccaggaggacaactggcggctcgagcaggaggcagaagagtgggaggag
gagcagtcctgcaagattccttcaactgcttctgaatctcaagagctctctcctgagtcg
gggctagatccacctgcagcccacgagcagagcctgcgctctctgtcctcggagcacgcc
atgattgcaaaggagcagactgctaaagccattgccaacgcagccaacgtctacgagaag
aacggcgtggaggcagcgctctgcgaggcattccacgaggagtactccagactctatctc
ctttccaaagagaccccgacccctcagaacgatgcccgcttgcaacacgtgctcgtttac
ttccttcagaacgatgctccccagcagattgtggaacggaccctcctcgagcagtttgca
gacaaaaacctcagctacgatgaaaggtccattagcatcatgaaggtagcacgagataaa
ctgaaagagatcggtcctgatgaggtcaatatggaggagtataagaagtggcatgaggac
tacagtctttttcggaaggtgtctgtttacctgcttacagggttggagctgtaccagaat
agaaagtacaaggagtccctgacctacctgatctatgcctaccaaagcaacaccactctg
ctgaagaagggagccaacagaggagtgaatgaatcgctgatcaccttgtatagaagaaag
tgtctcttgaagctgaatgaggtggcatcatctctgtttgtaagctgtgaggaagcccat
gtggcagagggcattagcatcctgaatgagctgatcatcccctgtatgcacctcattaac
aactttgacatctccagagaagacatggatgccattgaggtcatgagaaaccgctggtgc
tcctatctgggacgagaagacatggacgcaagcctgcagatcaggctgggcgagctgctc
ccccgcctgctggacggctccacggaggtggtggtgctgaaggagcccccaaagatccgt
cccaactccccatacgacctctgcagccgctttgcagcggtgatggagtccatccatgac
gcctcgactgtgactgtgaagtag

DBGET integrated database retrieval system