KEGG   Gallus gallus (chicken): 428607Help
Entry
428607            CDS       T01006                                 

Gene name
PCMT1
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     428607 (PCMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 228 aa AA seqDB search
MAWKSGGASHSELIHNLRKNGIIKSDKVFEVMLATDRCHYAKYNPYMDSPQSIGFQATIS
APHMHAYALELLSDQLHEGAKALDVGSGSGILTACFSRMVGPKGQVVGIDHIKELVDDSI
NNVKKDDPTLLSSGRVKLIVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLI
LPVGPAGGNQMLEQYDKLEDGSVKMKPLMGVIYVPLTDKEKQWSRDEL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcctggaagtcgggcggcgccagccactccgagctcatccacaacctccgcaaaaat
ggaataatcaaatcggacaaggtatttgaagtaatgctggctacagaccgctgccactat
gcaaaatacaacccttatatggattctcctcaatctataggcttccaagcaacaatcagt
gctccacatatgcatgcatatgctcttgaacttctgtctgatcaattacacgaaggagcc
aaagcactcgatgtgggatctggaagtggaatccttacagcatgcttttcgcgaatggtt
ggtcccaaaggacaagttgtaggaattgatcatatcaaagaactagtagatgactcaata
aataatgtcaaaaaagacgatcccacattgctgtcttcaggaagagtgaaactgattgtg
ggagatggaagaatgggatacgcagaagaagctccctatgatgcaattcatgtaggagct
gcagcaccagttgtgccccaagcacttatagatcagttaaaacctggcggaagattgata
ttaccagttggtcctgcagggggaaaccagatgcttgaacagtatgacaaactagaagat
ggcagtgtcaaaatgaagcctctgatgggagtgatatatgtgcctttaacagataaagag
aagcagtggtccagggatgaattgtaa

DBGET integrated database retrieval system