KEGG   Geobacillus sp. GHH01: GHH_c19270Help
Entry
GHH_c19270        CDS       T02455                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ggh  Geobacillus sp. GHH01
Brite
Enzymes [BR:ggh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     GHH_c19270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1922732..1923955
Genome map
AA seq 407 aa AA seqDB search
MWKQSRKAMIVGFSFMLLLPLGMTNALAKTEPSYAKKPRISALHAPQLDQRYKDSFTIGA
AVEPYQLQNEKDVQMLKRHFNSIVAENVMKPINIQPEEGKFNFAEADQIVRFAKKHHMDI
RFHTLVWHSQVPQWFFLDKEGKPMVNETDPVKREQNKQLLLKRLETHIKTIVERYKDDIK
YWDVVNEVVGDDGKLRNSPWYQIAGIDYIKVAFQAARKYGGDNIKLYMNDYNTEVEPKRT
ALYNLVKQLKEEGVPIDGIGHQSHIQIGWPSEAEIEKTINMFAALGLDNQITELDVSMYG
WPPRAYPTYDAIPKQKFLDQAARYDRLFKLYEKLSDKISNVTFWGIADNHTWLDSRADVY
YDANGNVVVDPNAPYAKVEKGKGKDAPFVFGPDYKVKPAYWAIIDHK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgtggaaacaatcacggaaagcgatgatcgttggattctcgtttatgctgctgcttcct
ttagggatgacgaatgcattggcaaaaacggagccatcgtacgctaaaaagccgcgaatc
agcgcattgcacgccccgcaattggatcagcgctacaaagattcattcactattggggcg
gctgttgaaccttatcagctgcaaaatgaaaaagacgtacaaatgctaaagcgccacttc
aacagcattgtcgctgagaatgtcatgaaaccgatcaacatccaacccgaagaaggaaag
ttcaattttgctgaggcggatcaaatcgtccgatttgctaaaaaacatcatatggatatt
cgtttccatacactcgtttggcacagccaagtacctcaatggttctttcttgacaaggaa
ggtaagccaatggttaatgaaacagatccagtgaaacgtgaacaaaataaacaactgctg
ttaaaacgacttgaaactcatattaaaacgatcgtcgagcggtacaaagatgacattaag
tactgggacgttgtaaatgaggttgtgggggacgacggaaaactgcgcaactctccatgg
tatcaaatcgccggcatcgattatattaaagtggcattccaagcagctagaaaatatggc
ggagacaacattaagctttacatgaatgattacaatacagaagtcgaaccgaagcgaacc
gctctttacaatttagtcaaacaactgaaagaagagggtgttccgatcgacggcatcggc
catcaatcccacatccaaatcggctggccttctgaagcagaaatcgagaaaacgattaac
atgttcgccgctctcggtttagacaaccaaatcactgagcttgatgtgagcatgtacggt
tggccgccgcgcgcttacccgacgtatgacgccattccaaaacaaaagtttttggatcag
gcagcgcgctatgatcgtttgttcaaactgtatgaaaagttgagcgataaaattagcaac
gtcaccttctggggcatcgccgacaatcatacgtggctcgacagccgtgcggatgtgtac
tatgacgccaacgggaatgttgtggttgacccgaacgctccgtacgcaaaagtggaaaaa
gggaaaggaaaagatgcgccgttcgtttttggaccggattacaaagtcaaacccgcatat
tgggctattatcgaccacaaatag

DBGET integrated database retrieval system