KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101146660Help
Entry
101146660         CDS       T02442                                 

Gene name
ELP3
Definition
elongator complex protein 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 574 aa AA seqDB search
MEHLQEGEERHIQKKKGQMKRDCFVAVSFPRGLSLWLHFYPWWLCYGGAEMRQKRKGDLS
PAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPPQYRK
VLIPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGY
EPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLH
DALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSV
YEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEHFVQFFEDSPF
NTDFCLEESVGATKMELITSALDGSFLDAWHFILDIPMPLVSSGVEHGNLRELALARMKD
LGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGLLRL
RKCSEETFRFELGGGVSIVRELHVYGSVVPVSSRDPTKFQHQGFGMLLMEEAERIAREEH
GSGKIAVISGVGTRNYYRKIGYRLQGPYMVKMLK
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcaggagggagaggagaggcacatccaaaagaagaagggacagatgaag
cgggattgttttgtggctgtcagctttccccgtggtctgagtttgtggctgcatttttat
ccctggtggctctgctacggcggcgcagagatgaggcagaagcggaaaggagatctcagc
cctgctgagctgatgatgctgactataggagatgttattaaacaactgattgaagcccac
gagcaggggaaagacatcgatctaaataaggtgaaaaccaagacagctgccaaatatggc
ctttccgcccagccccgcctggtggatatcattgctgccgtccctcctcagtatcgcaag
gtcttgattcccaagttaaaggcgaaacccatcagaactgccagtgggattgctgttgtg
gctgtgatgtgcaaaccccacagatgtccacacatcagttttacaggaaatatatgtgta
tactgccctggtggacctgattctgattttgagtattccacccagtcttacactggctat
gagccaacctccatgagagctatccgtgccagatatgaccctttcctacagacaagacac
cgaatagaacagttaaaacaacttggtcatagtgtggataaagtggagtttattgtgatg
ggtggaacgtttatggcccttccagaagaatacagagattattttattcgaaatttacat
gatgccttatcaggacatacttccaacaatatttacgaggcagtcaagtattctgagaga
agcctcacaaagtgtattggaattactattgaaaccagaccagattactgcatgaagcga
catttaagtgacatgttgacctatggctgcacaaggctggagattggggtgcagagtgtt
tatgaagatgtggctagagacaccaacaggggccacactgtgaaggcagtgtgtgagtca
tttcacctggccaaagattccggttttaaagtggtggcccatatgatgcctgacctgcca
aacgtgggactagaaagagacattgaacattttgtgcaattttttgaggattcgccattt
aatactgatttttgtctagaagagagtgttggagcaactaaaatggaactcataacttca
gctcttgatggaagtttccttgatgcctggcactttatactggatattccaatgccttta
gttagctcaggagtagagcatggtaacctgagagagctggcacttgcaagaatgaaagac
ctcggaatacagtgtcgagatgtgagaaccagagaagttggaatccaagaaattcatcac
aaagtacggccataccaggttgaattggtaaggagagattatgttgcaaatggtggctgg
gaaacattcttgtcatacgaagacccggatcaagacattttgattggcctcctacgatta
cgcaagtgttcagaagaaactttccgtttcgaattgggtggaggtgtctccatagtacga
gagctgcatgtgtatgggagtgtagtccctgtgagcagccgggatcctactaaatttcag
catcagggatttggcatgctgctgatggaggaagcagaaagaatagctagagaagaacat
gggtctgggaaaatagccgtgatatcaggggtcggcaccaggaattattatagaaagatc
ggctacagattacaaggcccgtacatggtgaagatgctgaaataa

DBGET integrated database retrieval system