KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101146660Help
Entry
101146660         CDS       T02442                                 

Gene name
ELP3
Definition
(RefSeq) elongator acetyltransferase complex subunit 3
  KO
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101146660 (ELP3)
Transfer RNA biogenesis [BR:ggo03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    101146660 (ELP3)
Chromosome [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101146660 (ELP3)
   HAT complexes
    Elongator complex
     101146660 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
8
AA seq 547 aa AA seqDB search
MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDI
IAAVPPQYRKVLIPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEE
YRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGC
TRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQ
FTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVARILAFVPPWT
RVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQV
ELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELGGGVSIVRELHVYGS
VVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGP
YMVKMLK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagaagcggaaaggagatctcagccctgctgagctgatgatgctgactatagga
gatgttattaaacaactgattgaagcccacgagcaggggaaagacatcgatctaaataag
gtgaaaaccaagacagctgccaaatatggcctttccgcccagccccgcctggtggatatc
attgctgccgtccctcctcagtatcgcaaggtcttgattcccaagttaaaggcgaaaccc
atcagaactgccagtgggattgctgttgtggctgtgatgtgcaaaccccacagatgtcca
cacatcagttttacaggaaatatatgtgtatactgccctggtggacctgattctgatttt
gagtattccacccagtcttacactggctatgagccaacctccatgagagctatccgtgcc
agatatgaccctttcctacagacaagacaccgaatagaacagttaaaacaacttggtcat
agtgtggataaagtggagtttattgtgatgggtggaacgtttatggcccttccagaagaa
tacagagattattttattcgaaatttacatgatgccttatcaggacatacttccaacaat
atttacgaggcagtcaagtattctgagagaagcctcacaaagtgtattggaattactatt
gaaaccagaccagattactgcatgaagcgacatttaagtgacatgttgacctatggctgc
acaaggctggagattggggtgcagagtgtttatgaagatgtggctagagacaccaacagg
ggccacactgtgaaggcagtgtgtgagtcatttcacctggccaaagattccggttttaaa
gtggtggcccatatgatgcctgacctgccaaacgtgggactagaaagagacattgaacag
ttcacagagttttttgagaaccctgcttttcgtcccgatgggctgaaactctatcctacc
ctggtgattcgtgggaccgggctttatgagctttggaaatcaggaagatataagagttac
tctcctagtgacctggttgaattggtggctcggatcctagccttcgtgcctccatggact
cgagtgtaccgagtacagagggatattccaatgcctttagttagctcaggagtagagcat
ggtaacctgagagagctggcacttgcaagaatgaaagacctcggaatacagtgtcgagat
gtgagaaccagagaagttggaatccaagaaattcatcacaaagtacggccataccaggtt
gaattggtaaggagagattatgttgcaaatggtggctgggaaacattcttgtcatacgaa
gacccggatcaagacattttgattggcctcctacgattacgcaagtgttcagaagaaact
ttccgtttcgaattgggtggaggtgtctccatagtacgagagctgcatgtgtatgggagt
gtagtccctgtgagcagccgggatcctactaaatttcagcatcagggatttggcatgctg
ctgatggaggaagcagaaagaatagctagagaagaacatgggtctgggaaaatagccgtg
atatcaggggtcggcaccaggaattattatagaaagatcggctacagattacaaggcccg
tacatggtgaagatgctgaaataa

DBGET integrated database retrieval system