KEGG   Gloeobacter sp. JS: GKIL_2789Help
Entry
GKIL_2789         CDS       T02885                                 

Gene name
glgB
Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
glj  Gloeobacter sp. JS
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:glj00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2940554..2942764)
Genome map
AA seq 736 aa AA seqDB search
MYSTLERQAIEALAANLHSDPFAILGPHALVNDGQWVVRTFQPGAHSVRLVSEGGEVAMA
NAVHPDLFEAVLAGPPGAYRLRIVESWGEERIIDDPYRFRVAALSELDIHLFSEGNHNRI
YEKLGAHRAEYDGVAGVHFAVWAPNARNVSLLGDFNRWDGRIHQMRRLGDSGIWDLFIPG
LTVGTVYKFEIKNGFGHIYEKSDPYAFQMEVRPKSGSVVADLDGYEWHDADWLTRRAHTD
PLRAPLAIYEVHLGSWMRVPEEENRFLSYGELAERLIPYVQQMGFTHIELLPIAEHPFDG
SWGYQVLGYYAPTSRYGTPTEFMAFVDRCHRAGIGVILDWVPAHFPKDGHGLALFDGTHL
YEHADPRKGEHKEWGTLVFNYSRNEVRNFLTANALFWFERYHIDGIRVDAVASMLYLNYG
RKDGEWVANDYGGQENLEAISFLRQLNELIFKYFPGALSIAEESTAWPLVSRPTYLGGLG
FNLKWNMGWMHDTLRYFKTDPFFRRYQHNDITFSITYTFFENFVLALSHDEVVHMKGSMI
GKMPGDSWQKFANLRALYTFMYGHPGKKTIFMGMEFAQGREWNVWQSLDWHLLDYPQHQQ
MQRFFSDLNHLYTGEAALYEEDTSPSGFFWIDCHDYTNSVFSFVRQGKDPDERLLFVCNF
TPSYHTHYRVGVPQAGFWQEIFNSDASLYGGGNQGNQGGIASEDWAVQGQPYSLALRLPP
LGCLIFKRRAEANERP
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgtattctactcttgaaaggcaggcgatcgaagccctcgctgcgaacttgcacagcgac
ccgttcgcgatcctcggtccgcacgcactggtaaacgacgggcagtgggtagtgcgcacc
tttcagccgggagcacactcggtccgccttgtatctgaggggggcgaggtggcgatggca
aatgccgtccatcctgacctcttcgaggcggtgcttgccgggccgccgggcgcttatcgg
ttgcggattgtcgaaagctggggagaggagcggatcatagacgatccctatcgctttcgg
gtagcagccttgagcgagctggatattcatctattttctgagggcaaccataaccggatc
tacgaaaagctgggagcccacagggccgaatacgacggtgtggcgggcgttcattttgcg
gtctgggcaccaaatgcccgcaacgtcagtttgctgggggattttaaccgttgggatggc
cgcattcaccagatgcggcggctgggcgactcggggatctgggatctgtttattcccggc
ctgacggtgggaacggtctataagttcgagatcaaaaatggctttggccacatctacgaa
aagtctgacccctacgccttccagatggaagtacggcccaaaagtggctcggtagtagcg
gacctggacggctacgaatggcacgacgcggactggctcacccgccgcgcccacaccgac
ccgctcagggcaccgcttgccatctacgaggttcacctcggctcctggatgcgcgtgccc
gaggaggagaaccgctttttgagctacggcgaactggcggagcggctcattccctacgtc
cagcagatgggctttacccatatcgaactgttgcccatcgccgaacatcccttcgacggc
agctggggctaccaggtgctggggtactacgcccctacctcccgctacgggacaccgacc
gagttcatggccttcgtcgatcgctgccatcgcgcgggcatcggtgtgatcctcgactgg
gttcccgcccactttcccaaggacggccacggccttgccctcttcgacggcacccacctc
tacgagcacgccgatccgcgcaagggcgaacacaaggagtgggggacgctcgtcttcaac
tactcgcgcaacgaagtgcgcaacttcctgacagcgaacgccctgttctggttcgagcgc
tatcacatcgacggcatccgggtcgatgcggtggcctcgatgctctacctcaactacggg
cgcaaggacggcgagtgggtggccaatgactacggcggtcaagaaaatctcgaagcgatc
agctttttgcgccagctcaacgaactgatcttcaagtattttcccggtgcgctctcgatc
gccgaagaatcgaccgcctggcccctggtctcccgccctacctacctgggcgggctgggt
tttaacttgaagtggaacatgggctggatgcacgacacgctgcgctacttcaagaccgac
ccgttcttccggcgctaccagcacaacgacatcaccttctcgatcacctatacgttcttc
gagaacttcgtgctcgccctctcccacgacgaggtcgtacacatgaaaggctcgatgatc
ggcaagatgcccggcgacagctggcaaaaatttgccaacctgcgcgccctctacacgttt
atgtacgggcatccgggcaaaaagacgatcttcatgggcatggaatttgcccaggggcgc
gagtggaatgtctggcaatccctcgactggcacctgctcgattacccccagcaccagcag
atgcagcggttcttcagcgacctcaaccacctctacaccggcgaggcggccctctacgag
gaggacaccagccccagcggctttttctggatcgattgccacgactacaccaacagcgtc
ttttccttcgtccgccagggcaaagaccccgacgagcggctattgttcgtctgcaacttc
acgccgagctaccacacccactaccgggtcggagtgccccaggccggtttctggcaggag
atcttcaacagcgacgccagcctctacggcggcggcaaccagggcaaccagggcggtata
gcgagcgaggactgggcggtgcagggccagccttactccctcgctctgcggttgcccccc
ctgggctgtcttatcttcaaacgccgggctgaggccaatgagcgcccctga

DBGET integrated database retrieval system