KEGG   Geobacter metallireducens: Gmet_0407Help
Entry
Gmet_0407         CDS       T00295                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
gme  Geobacter metallireducens
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:gme00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:gme00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
449113..450648
Genome map
AA seq 511 aa AA seqDB search
MRLEDLARVINPSEAGGSLALEIEGLYCDSRQVRSGGLFFALRGVATDGHDYIVASRDRG
AVAVVVEDPSRVPEGMTWLKVDDARLAMSRAAAAFYGNPTDGIPVVGITGTNGKTTTTYL
VEAVMARAGIPVAVLGTISYRFGDKTIPAPHTTPESVDLQRTIRDLVDRGAQGVVMEVSS
HALEQRRVDGCRFDVGVFTNLTRDHLDYHRDMESYFESKARLFTELLAADDTKPRRAAVI
NVDDPYGARLASDAVAPVVSYGLSPSVMVRAEMVTFSVDGISGTLVTPLGTIPFHSRLLG
RFNLYNILAAVAAGVALGLSPDAIRGGIEGDVRVPGRLERVDNDHGITVLVDYAHTGDAL
ENVLKTVAEIATGRIITVFGCGGDRDRGKRPVMGEIAGRFSDLSIVTSDNPRTEDAGAII
GEILGGIRSLGLREYGAEELITGFDAKGFAAVESRREAIRLAARVARPGDVLLLAGKGHE
DYQIIGTMKHHFDDREEVAAAFRELSSKGQG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagactggaagatctggcacgggtcattaatccctctgaagcaggaggatctctggcg
ctggagatcgaagggctctactgcgattcacggcaggtgcggtccggcggtctctttttc
gcgttgaggggcgtggcgacagacggccatgattacattgtcgcctcccgcgaccgtggc
gcggttgccgtggtggtggaggatccgtcgcgggtccccgaaggaatgacctggctgaag
gtcgatgacgcgcgtcttgccatgtcccgtgctgccgcagccttctacggcaaccccacc
gatggtattcccgtggtcggtatcacggggaccaacggaaagacgaccactacgtacctg
gtggaggccgtcatggcccgagccggcatccctgtggcggttctcgggactatcagttac
cgcttcggtgacaagactatcccggctccccacacgactcccgagtcggtagatctgcag
cggaccatacgcgatctggtggaccggggcgcccaaggtgtggtcatggaggtttcctcc
catgcccttgagcagcgacgggtggatggatgccgcttcgatgtcggcgtcttcaccaat
ctcacccgtgaccacctggactatcatcgggacatggagtcgtacttcgaaagcaaggcg
cggctatttaccgagcttctggcagcggacgacacgaaaccccgacgtgccgcggttatt
aacgtggacgacccctatggcgcccgactcgccagtgacgcggttgcgccggtggtgagc
tacgggctgtctccttcagtcatggtccgggccgagatggtcaccttttctgtcgatgga
atctctggtaccctcgttaccccccttggtacgataccgtttcactcgcggcttctgggg
cggttcaacctctacaacatcctggcggctgtggcggctggcgtggccctgggactctcc
ccggatgcaattcgcgggggaatcgagggggatgtccgggtccctggacgccttgagcgg
gttgataacgaccatgggatcacggtgctggtcgattatgcccacacgggcgacgccctg
gagaatgtcctgaagaccgttgccgagatcgccaccggccggatcatcactgtattcggc
tgcggcggagaccgggatcggggaaaacggcccgtcatgggggagattgcagggcgtttc
agcgatctatccatcgtcacctccgacaacccgcgaaccgaggatgccggagcgattatt
ggcgagattctcggcggtatccgttctcttgggctccgggagtatggggcggaagaactc
atcaccggtttcgatgccaaaggatttgctgcggtggaatcgagacgcgaggcaatcagg
ctggccgcccgcgtggcacgtcctggggatgttctgctcctcgctggcaagggacacgag
gactaccagattatcgggacgatgaagcaccacttcgacgatcgggaagaggttgctgcc
gcttttcgggaactgtcatccaaaggacagggatag

DBGET integrated database retrieval system