KEGG   Glycine max (soybean): 100804624Help
Entry
100804624         CDS       T01710                                 

Definition
xylose isomerase-like
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
gmx  Glycine max (soybean)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:gmx00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:gmx00051]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 480 aa AA seqDB search
MMKMKLVKTLLLLLCVKLFCYAVIGAPQTCPANNEDKCGDSDEWKGEFFPDIPKIKYEGP
SSKNVLSFKWYNAEEEILGKKMKDWLRFSVAFWHTFRGTGADPFGAPTKYWLWEDGTNSL
NMAKRRMRANFEFISKLGVDFWCFHDRDIAPDGKTLEESNANLDEVVALAQELQTKAKKR
VLWGTAQLFMHPRYMHGAATSSELKVYAYAAAQVKKAIEVTHYLGGENYVFWGGREGYQS
LLNTDMERELNHLARFFEAAVAYKKKIGFNGTFLIEPKPQEPTKHQYDWDAATSANFLRK
YGLTGEFKLNIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQ
EATLIMLSVIRNGGLAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTLARGLRNAAKLIED
GSLAELVRKRYQSFDTEIGAQIEAGKADFELLEKKVKEWGEPKVASAKQELAEMILQSVL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatgaaattggtgaaaacattactgcttctcctttgtgtgaaactcttctgt
tatgcagtgattggtgctcctcaaacttgtcctgctaacaatgaggataaatgcggcgat
tcagatgaatggaaaggggagtttttccctgacattcccaaaattaaatatgagggtccg
tcaagtaagaatgtgctttcatttaaatggtataatgcagaggaggaaattcttgggaag
aagatgaaggattggttaagatttagtgttgcattttggcatacattccgtggaacaggt
gctgacccatttggtgcacctaccaaatactggctatgggaagatggtaccaattcatta
aacatggctaaaagacgaatgagagctaactttgagttcataagcaaactcggtgttgac
ttttggtgtttccacgacagggatatagcccctgatggaaaaactcttgaggaatctaat
gcaaacttggatgaagtggttgcccttgctcaagagctccagactaaggctaaaaaaaga
gtgttatggggaacagctcagttgttcatgcatcctcgttacatgcatggtgctgctact
agctctgaattaaaggtctatgcatatgctgctgctcaagtgaagaaagccatagaggtg
acacattatttggggggagaaaattatgttttctggggtggtcgtgaaggttatcaatct
cttttgaacacagatatggagcgagagcttaatcatttggctaggttttttgaagctgct
gttgcatacaaaaagaagattggattcaatgggacatttctaatcgaaccaaagccacaa
gaacctacaaaacaccagtatgattgggatgctgcaacctcagctaatttcttgcgaaaa
tatggacttacaggggaattcaaactcaacatagagtgcaaccatgccaccctctctggc
cacagttgtcatcatgagctcgaaactgcaaggatcaatggattgctgggtaatattgat
gcaaacactggtgatcctcaagttggttgggacactgatcagtttcttgtagatattcaa
gaggcgacactgattatgctcagtgtgatcagaaatggaggacttgcacccggtggattc
aacttcgatgcgaaattgcggagagagagcacagatgttgaagacttgttcatagcccac
attgttggaatggataccctggcccgtggcctgaggaatgctgccaagttgattgaggat
ggttctcttgctgagcttgttcgtaagcgttatcagagttttgacactgaaattggggct
caaatagaggctggtaaggctgactttgaactgcttgagaagaaggtcaaggaatgggga
gaaccaaaggttgcttctgcgaaacaggagctagccgagatgatcctccaatctgttctg
tag

DBGET integrated database retrieval system