KEGG   Glycine max (soybean): 100810259Help
Entry
100810259         CDS       T01710                                 

Definition
(RefSeq) pectinesterase 31-like
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00040  Pentose and glucuronate interconversions
gmx01100  Metabolic pathways
Module
gmx_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100810259
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     100810259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase Beta_helix DUF4280
Motif
Other DBs
NCBI-GeneID: 100810259
NCBI-ProteinID: XP_003543834
UniProt: I1LWM4
Position
13
AA seq 316 aa AA seqDB search
MAALVITVSQDGTGQYRTVQEAIDAVPLGNTRRTVIRVSPGTYRQPLYVAKTKNFITLVG
LRPEDTVLTWNNTATSIHHHQDARVIGTGTFGCGTIIVEGGDFIAENITFENSSPQGAGQ
AVAVRVTVDRCAFYNCRFLGWQDTLYLHYGIQYLKDCYIEGSVDFIFGNSTALLEHCHIH
CKSAGFITAQSRNSPQEKTGYVFLRCVVTGNGGTSYAYLGRPWRPFARVVFAFTYMDQCI
KPAGWNNWGKIENEKTACFYEYRCFGPGWCPSQRVKWARELQAEAAEQFLMHSFIDPESE
RPWLAQRMALKIPYSA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcttgtaataactgtgtcacaagatggaaccggacagtacaggacggtgcag
gaagccatagatgctgtgccactcggcaacactcgccggacggtgattagggtgtccccg
ggaacctaccggcagcccctctacgtggcaaagactaagaacttcatcaccctcgttggt
ctgcgccccgaggacactgttctcacttggaacaacactgccacctcaatccaccaccac
caggatgctagggtgatagggactggaacctttggttgtggcaccatcattgtggaaggg
ggggactttattgctgagaatattaccttcgagaattcttcccctcagggtgcagggcaa
gcagtagcagttagagtaacagtagatcgttgtgctttctataattgcaggttccttgga
tggcaggacacactatatttacattatggaatacaatatttgaaagattgttatattgaa
ggaagtgtggacttcatatttggcaatagtactgcactcttggaacattgtcacatccat
tgcaagtccgcagggttcataactgctcaaagcagaaactctccacaggaaaaaactggt
tatgtattcctcagatgtgttgtcacaggtaatgggggaacttcatatgcatatcttgga
agaccatggagacctttcgcaagagtggtctttgcattcacttacatggatcaatgtata
aagcctgctggctggaataattgggggaaaattgagaatgaaaaaactgcttgcttctat
gaatacaggtgttttggacctggttggtgtccatcccaacgagtaaaatgggctagagaa
ttacaagctgaagcagcagagcagtttctcatgcatagcttcattgacccagaatcagag
agaccttggcttgctcaaagaatggctctgaagattccatattctgcttaa

DBGET integrated database retrieval system