KEGG   Gordonia sp. KTR9: KTR9_3013Help
Entry
KTR9_3013         CDS       T02216                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysine ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
gor  Gordonia sp. KTR9
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:gor00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:gor00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3480046..3481713)
Genome map
AA seq 555 aa AA seqDB search
MASRRRSQDPRGGPIRPSEVTPTLVSVLSTATGARLDLVGGADAESTVTGVTLRAQEVRP
GDLFAALPGSSTHGARFADQAVAAGASAILTDPAGRAELARVLPPETAVAVLIHPAPRTV
LGNVSARVYGNPSQRLKLIGVTGTSGKTTTSYLVEAALLAAGHSVGLIGTVETRVNGVAQ
PSSLTTPEAPTLQALLAAMLEDGVDIVVMEVSSHALALGRVDGAHFAIGAFTNLSQDHLD
FHQTMRAYFDAKAQLFVPSAPTHAVRAVVCVDDEWGRRMAELARRPGESAHLQPVTVSTG
PTPAHWHAGESSLDPDGSSRTPFSEPDGTHELRIPLPGRYNVANGLLAVAVAHAAGVSVP
TALEAVASVSVPGRLQRIDRGQPFLALVDYAHKPGAVDAVLTTLRGQSTGRVAIVIGAGG
DRDTGKRPLMGEAAARGAELVVVTDDNPRTEDPGAIRAEVLAGAYAVPVTERPRDAEPVR
EIGDRAAAVEAAIAWAQPGDIVLVAGKGHEAGQEINGVKHPFDDREVVARALESRAATSR
ATGTTRGPDAAAEER
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcgtcgacgatcacaagacccgcgtggtggacccatccgtcccagcgaggtc
acgccgacacttgtgtccgtgctgtccaccgccaccggggccaggctcgacctcgtcggc
ggcgccgacgccgagtcgaccgtgaccggggtgacgctgcgtgcccaggaggtccggccc
ggtgatctgttcgccgcgctgcccgggtcgagcacgcatggcgcgcgattcgccgaccag
gccgtggcggccggtgcgtcggccatcctcaccgatcccgccggccgggccgagctcgcc
cgcgtgctgccgccggagaccgccgtcgcggtcctcatccatcccgcgccgcgcacggtc
ctcggcaacgtcagtgcgcgcgtctacggcaacccgtcgcagcggctcaagctgatcggt
gtcaccggcacgtcgggtaagaccaccacgtcctacctcgtcgaggccgccctgctggcc
gccggccactccgtcggactgatcggcaccgtcgagacgcgcgtgaacggcgtcgcccag
ccgagttcgctgaccaccccggaggcgccgaccctgcaggccctgctcgcggcgatgctc
gaggacggcgtcgacatcgtggtcatggaggtgtcgagtcacgcgctggcgctcggccga
gtcgacggtgcgcatttcgcgatcggcgcgttcaccaacctctcgcaggaccatctcgac
ttccaccagacgatgcgcgcctacttcgacgccaaggcgcagctgttcgtcccgtccgcc
cccacccatgccgtccgggcggtcgtctgcgtcgacgacgagtggggtcgacggatggcc
gagctcgcccggcggccgggagagtccgcccatctgcagccggtcacggtgtccaccggg
ccgacgccggcccactggcacgccggtgagtcgtcgctcgatcccgacggttcgtcacgc
acaccgttctccgagccggacggaacccacgagctccgcatcccgctgcccggccggtac
aacgtggccaacggtctgctcgccgtcgccgtcgcgcacgccgcgggggtgtcggtgccg
acggcgctcgaggcggtggcgtcggtgagcgtgccgggacggttgcagcgcatcgaccgc
gggcagcccttcctggccctggtcgactacgcgcacaaaccgggagcggtcgacgcggtg
ctgacgacgctgcgcgggcagtcgaccggacgggtcgccatcgtcatcggtgccggcggc
gaccgggacaccgggaaacgtccgctgatgggggaggccgccgcgcgcggcgccgaactc
gtcgtcgtcaccgacgacaacccccgcaccgaagatccgggcgcgatccgcgccgaggtg
ctcgccggggcgtacgccgtgccggtgaccgagcgaccccgtgacgccgaacccgtccgg
gagatcggcgatcgcgccgcggccgtcgaggcggcgatcgcgtgggcgcagcccggtgac
atcgtgctggtcgccggcaagggacacgaagcaggtcaggagatcaacggcgtgaagcat
ccgttcgacgaccgcgaggtcgtcgcccgtgcgctggagtcccgcgcggcgacatcgcgg
gcgacggggaccacccgcggccccgacgcggcggccgaggagcggtga

DBGET integrated database retrieval system