KEGG   Gamma proteobacterium HdN1: HDN1F_24260Help
Entry
HDN1F_24260       CDS       T01300                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gpb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2990847..2991644)
Genome map
AA seq 265 aa AA seqDB search
MLAKLPLSALTAATTDTATVESFAIEKAALEAASSAPYKLNLETTSERIRQRLIKAGQRF
HANDNIAAYLKDGEREAIQAEVETHMQQVLRALVIDTDHDHNTVETAKRVAKMFVQEVFR
GRFEGTPSVTAFPNVSQLNELMVVGPITVRSACSHHLCPIMGKVWIGVLPNAESDLIGLS
KYARLCDWVMSRPQIQEEAVVMLADELEQRIRPDGLAVVMEANHFCMHWRGVKDNHSLMK
NSVMRGAFLKDAALRREFLSLLDKG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgttagcgaaacttccactttctgcacttactgcagccaccacggatactgccacagtt
gaatcgtttgccatcgaaaaagctgcgctggaagccgctagcagcgcaccctataaactc
aatttagaaaccacgtcagaacgcattcgccagcgtttaatcaaggcgggacagcgcttc
cacgccaacgacaatatcgcggcctatctgaaagacggcgagcgcgaagcgatacaagcg
gaagtcgaaactcatatgcagcaagtactacgggcgttggtcattgacaccgaccacgac
cacaatacggtagaaaccgcaaaacgtgtcgcgaaaatgtttgtacaagaagtctttcgc
ggacggtttgaaggcacgccatcggtaacggcctttcccaacgtatcgcagctgaacgag
ctgatggtagtcggccccatcaccgtgcgcagcgcctgttcccaccacctttgcccgatc
atggggaaagtctggatcggcgtattgcccaacgcggaatcggatttgatcggactgtcg
aaatatgcccgcctttgcgattgggtcatgagccgcccgcaaattcaagaagaagccgtg
gtgatgctcgccgatgagttggagcagcggattcgcccagacggactggccgtggtcatg
gaggcgaatcacttctgtatgcattggcggggcgtgaaagacaaccattcgctgatgaaa
aattcggtaatgcgcggcgcttttctgaaagatgcagcattacggcgggaatttttaagt
ttgctagacaagggttag

DBGET integrated database retrieval system