KEGG   Gamma proteobacterium HdN1: HDN1F_29370Help
Entry
HDN1F_29370       CDS       T01300                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HDN1F_29370 (folE)
Enzymes [BR:gpb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     HDN1F_29370 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3623425..3624147)
Genome map
AA seq 240 aa AA seqDB search
MSSQKPPAIPDEGTPPISTTIRERITASGTRFNANDNIAAFIQPGELELLQQEVAERFQA
VLESLVIDTQSDHNTRETAERVARMYIQEVFEGRYTPAPSVTEFPNAERLGELMIVGPIT
IRSACSHHFCPIIGRLWIGVLPNEQSNLIGLSKYARLATWIMGRPQIQEEAVVQLADLLQ
TKMKPDGLAIVMEADHFCMHWRGVRDNDSKMLNSVMRGAFLVNSDLRREFLSLLPKRTSD
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
ttgagcagccaaaagccccccgccatccccgacgagggcacccctccgatttccacaacg
atccgcgagcgcataacggctagtggaacccgcttcaacgcaaacgacaatatcgctgca
ttcatccagccaggcgaactcgaattacttcagcaagaagtagccgaacgtttccaggcg
gttctagagagcctcgtcatcgacacccaaagcgaccacaacacccgcgaaaccgcagag
cgcgttgcgcgcatgtacattcaagaagtctttgaaggccggtatacccccgcccccagc
gtcaccgaatttccaaacgcagagcgcttgggcgaactcatgatcgtcggccccatcacc
atccgaagcgcctgctcacaccatttctgccccatcattgggcggctctggatcggcgtt
ctgcccaacgaacaatccaacctgattggcctttccaaatacgcgcggctcgctacttgg
atcatgggccgtccccaaatccaagaagaagccgtcgtgcagctcgcagatcttctacaa
accaaaatgaaacccgacggcctcgccatcgtcatggaagccgaccacttctgcatgcac
tggcgcggcgttcgcgacaacgattccaaaatgctcaacagcgtcatgcgcggcgcattt
ttggtcaactccgacttgcggcgcgaattcctgtcgttacttcccaagcgcacgagcgac
tga

DBGET integrated database retrieval system