KEGG   Geobacillus thermoglucosidasius: Geoth_0035Help
Entry
Geoth_0035        CDS       T01531                                 

Definition
deoxyadenosine kinase (EC:2.7.1.76)
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:gth00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:gth00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(23695..24363)
Genome map
AA seq 222 aa AA seqDB search
MNLREKYRIPDNAIITIAGTVGVGKSTMTKALAKALNFRTSLEKVDTNPYLDKFYADFER
WSFHLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDAHIFAKMHFENGTMTAVDYETYTS
LFQAMVMTPYFPHPDLLIYLEGSFEEVIKRIRERGRPMEQKTPVSYWKEMYERYEKWINE
FNACPVLRVNINEYDIIEDEQSIEPIIKKAATIIHEYYHINK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacgtgaaaaatatcgtattccagataacgccatcattacgattgccggaaca
gttggcgtcggtaaatcaaccatgacaaaagcattagcaaaagcgttaaatttccgcact
tccctagaaaaagtcgatacgaatccatatttagacaagttttatgctgattttgaacgg
tggagtttccatttgcaaatctattttcttgccgagcggtttaaagaacaaaaacgaatg
tttgaatatggcggcggctttgttcaagatcgttcaatttacgaagacgcgcatattttc
gcaaaaatgcattttgaaaatggaacaatgacagcagtagattacgaaacatatacgagc
ttatttcaagcaatggtaatgacaccatatttcccgcatcctgatttgcttatttatttg
gaaggaagttttgaagaagtgataaaacgtatccgtgagcgcgggcgcccaatggaacaa
aaaacaccggtatcatattggaaagaaatgtatgaacgttacgaaaaatggattaatgaa
tttaacgcttgtccggttcttcgcgtaaacattaacgaatatgatattatcgaagacgag
cagtccatcgaaccaatcattaaaaaagcggcaacgattattcatgaatattatcacata
aacaaataa

DBGET integrated database retrieval system