KEGG   Gardnerella vaginalis 409-05: HMPREF0424_1311Help
Entry
HMPREF0424_1311   CDS       T01146                                 

Definition
aminotransferase AlaT (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
gva  Gardnerella vaginalis 409-05
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gva00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    HMPREF0424_1311
   01230 Biosynthesis of amino acids
    HMPREF0424_1311
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF0424_1311
   00290 Valine, leucine and isoleucine biosynthesis
    HMPREF0424_1311
Enzymes [BR:gva01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     HMPREF0424_1311
    2.6.1.66  valine---pyruvate transaminase
     HMPREF0424_1311
Amino acid related enzymes [BR:gva01007]
 Aminotransferase (transaminase)
  Class I
   HMPREF0424_1311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1566274..1567800
Genome map
AA seq 508 aa AA seqDB search
MAQNFADELKKAMKRKGYKQIDVIELAAKNGHKLGKSQLSQYLSGKTEPRKDVRNMLAEI
LGISSDGIKGGHSCAKIEQNCQSAEEPQLNQPQLTEAELSQTLKHRTFNKSTKLEHVLYD
VRGPVVEEANRMEANGTHILKLNIGNPAPFGFRAPDEVIYDMQQQLIDCEGYSDSRGLFS
ARKAIMQYDQLKGIPGVQMEDIYTGNGVSELINLSMQALLDCGDEILIPSPDYPLWTACA
SLAGGTPVHYMCDEKSHWYPDIADIRSKITPRTKAIVIINPNNPTGVLYSREVLEEIVKI
AREFNLIIFADEIYDRLVMDGKKHISIASLAPDVFCVTFSGLSKSHMIAGFRIGWMSLSG
DKSKARDYIMGLNMLSNMRLCSNVPAQSIIQTALGGYQSVEKYLEPGGRVYEQREYCYNA
LQEMDGVSVERPDAAFYMFVKLDPSRYNIHDDEQFALDLLRDQKLLIVHGKGFNWQTPGY
FRVVYLPRLQTLRDAMGKLANFLSYYRQ
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcacagaattttgctgatgagcttaaaaaagctatgaagcgtaaggggtacaagcag
attgacgtaatcgagcttgcagcaaaaaacggtcataaacttggtaaaagccagttaagc
cagtatttaagcggcaaaaccgagcctcgcaaagacgtacgtaacatgctagctgaaatt
cttggaatcagcagcgacggaatcaaaggcggtcattcttgtgcaaaaatcgagcaaaac
tgccagtctgcagaagaaccacaattaaatcagccacagcttacagaagctgaactttcc
caaacactcaaacatagaaccttcaacaaatcaaccaaactcgagcacgtgctttatgac
gttcgcggcccagttgttgaagaagcaaaccgcatggaagcgaacggaacgcatattcta
aagctcaacattggaaatcctgcgcctttcggattccgcgctccagacgaagtgatttac
gacatgcaacagcagcttattgactgcgaaggctactcggatagtcgtggacttttctcc
gctcgcaaggcgattatgcaatacgatcagcttaagggcattccaggcgtgcaaatggaa
gatatttacactggaaacggagtttccgagctgattaatctttctatgcaagcgctgctt
gattgcggcgacgagattcttatcccaagcccagactatccgttgtggactgcgtgcgct
agcctggctggaggtactcctgtgcactacatgtgtgacgaaaagtcgcattggtaccca
gatattgccgacattcgctctaaaatcacgcctcgcactaaagcaatcgtgattattaac
ccgaataatcctacgggtgtgctgtatagtcgcgaagttttggaagagattgttaagatt
gcgcgcgagtttaatttgattatttttgcggacgagatttacgaccgtcttgttatggat
ggcaagaagcatatttcgattgcttctcttgctccagacgtattctgcgtaactttcagc
ggactttctaagtcgcatatgattgctggcttccgtattggttggatgagtctttcggga
gataaatccaaggctcgcgactacattatgggtcttaatatgctgtctaatatgcgcttg
tgctcgaacgttcctgcgcagtcaattattcagactgctttgggcggataccagagcgtt
gaaaagtatttggaaccaggcggacgcgtgtatgagcagcgcgagtattgctataacgcg
cttcaagagatggatggcgtaagcgttgagcgaccagacgctgctttctacatgtttgta
aagctcgatccaagtcgatacaacattcacgacgacgaacagtttgcgcttgatttgcta
cgcgatcagaagttgctgattgtgcacggcaaaggctttaattggcagactccaggctac
ttccgcgtagtctacttgccgcgcttgcaaacgcttcgtgacgcaatgggcaaactcgct
aacttcctctcctactatcgccagtag

DBGET integrated database retrieval system