KEGG   Gardnerella vaginalis 409-05: HMPREF0424_1311Help
Entry
HMPREF0424_1311   CDS       T01146                                 

Definition
aminotransferase AlaT (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
gva  Gardnerella vaginalis 409-05
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:gva01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gva01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gva00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:gva00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1566274..1567800
Genome map
AA seq 508 aa AA seqDB search
MAQNFADELKKAMKRKGYKQIDVIELAAKNGHKLGKSQLSQYLSGKTEPRKDVRNMLAEI
LGISSDGIKGGHSCAKIEQNCQSAEEPQLNQPQLTEAELSQTLKHRTFNKSTKLEHVLYD
VRGPVVEEANRMEANGTHILKLNIGNPAPFGFRAPDEVIYDMQQQLIDCEGYSDSRGLFS
ARKAIMQYDQLKGIPGVQMEDIYTGNGVSELINLSMQALLDCGDEILIPSPDYPLWTACA
SLAGGTPVHYMCDEKSHWYPDIADIRSKITPRTKAIVIINPNNPTGVLYSREVLEEIVKI
AREFNLIIFADEIYDRLVMDGKKHISIASLAPDVFCVTFSGLSKSHMIAGFRIGWMSLSG
DKSKARDYIMGLNMLSNMRLCSNVPAQSIIQTALGGYQSVEKYLEPGGRVYEQREYCYNA
LQEMDGVSVERPDAAFYMFVKLDPSRYNIHDDEQFALDLLRDQKLLIVHGKGFNWQTPGY
FRVVYLPRLQTLRDAMGKLANFLSYYRQ
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcacagaattttgctgatgagcttaaaaaagctatgaagcgtaaggggtacaagcag
attgacgtaatcgagcttgcagcaaaaaacggtcataaacttggtaaaagccagttaagc
cagtatttaagcggcaaaaccgagcctcgcaaagacgtacgtaacatgctagctgaaatt
cttggaatcagcagcgacggaatcaaaggcggtcattcttgtgcaaaaatcgagcaaaac
tgccagtctgcagaagaaccacaattaaatcagccacagcttacagaagctgaactttcc
caaacactcaaacatagaaccttcaacaaatcaaccaaactcgagcacgtgctttatgac
gttcgcggcccagttgttgaagaagcaaaccgcatggaagcgaacggaacgcatattcta
aagctcaacattggaaatcctgcgcctttcggattccgcgctccagacgaagtgatttac
gacatgcaacagcagcttattgactgcgaaggctactcggatagtcgtggacttttctcc
gctcgcaaggcgattatgcaatacgatcagcttaagggcattccaggcgtgcaaatggaa
gatatttacactggaaacggagtttccgagctgattaatctttctatgcaagcgctgctt
gattgcggcgacgagattcttatcccaagcccagactatccgttgtggactgcgtgcgct
agcctggctggaggtactcctgtgcactacatgtgtgacgaaaagtcgcattggtaccca
gatattgccgacattcgctctaaaatcacgcctcgcactaaagcaatcgtgattattaac
ccgaataatcctacgggtgtgctgtatagtcgcgaagttttggaagagattgttaagatt
gcgcgcgagtttaatttgattatttttgcggacgagatttacgaccgtcttgttatggat
ggcaagaagcatatttcgattgcttctcttgctccagacgtattctgcgtaactttcagc
ggactttctaagtcgcatatgattgctggcttccgtattggttggatgagtctttcggga
gataaatccaaggctcgcgactacattatgggtcttaatatgctgtctaatatgcgcttg
tgctcgaacgttcctgcgcagtcaattattcagactgctttgggcggataccagagcgtt
gaaaagtatttggaaccaggcggacgcgtgtatgagcagcgcgagtattgctataacgcg
cttcaagagatggatggcgtaagcgttgagcgaccagacgctgctttctacatgtttgta
aagctcgatccaagtcgatacaacattcacgacgacgaacagtttgcgcttgatttgcta
cgcgatcagaagttgctgattgtgcacggcaaaggctttaattggcagactccaggctac
ttccgcgtagtctacttgccgcgcttgcaaacgcttcgtgacgcaatgggcaaactcgct
aacttcctctcctactatcgccagtag

DBGET integrated database retrieval system