KEGG   Gardnerella vaginalis 409-05: HMPREF0424_1311Help
Entry
HMPREF0424_1311   CDS       T01146                                 

Definition
(GenBank) DNA-binding helix-turn-helix protein
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
gva  Gardnerella vaginalis 409-05
Pathway
gva00220  Arginine biosynthesis
gva00250  Alanine, aspartate and glutamate metabolism
gva00290  Valine, leucine and isoleucine biosynthesis
gva01100  Metabolic pathways
gva01110  Biosynthesis of secondary metabolites
gva01130  Biosynthesis of antibiotics
gva01210  2-Oxocarboxylic acid metabolism
gva01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gva00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF0424_1311
   00290 Valine, leucine and isoleucine biosynthesis
    HMPREF0424_1311
   00220 Arginine biosynthesis
    HMPREF0424_1311
Enzymes [BR:gva01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     HMPREF0424_1311
    2.6.1.66  valine---pyruvate transaminase
     HMPREF0424_1311
Amino acid related enzymes [BR:gva01007]
 Aminotransferase (transaminase)
  Class I
   HMPREF0424_1311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 HTH_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADB13803
UniProt: D2RCG4
Position
1566274..1567800
Genome map
AA seq 508 aa AA seqDB search
MAQNFADELKKAMKRKGYKQIDVIELAAKNGHKLGKSQLSQYLSGKTEPRKDVRNMLAEI
LGISSDGIKGGHSCAKIEQNCQSAEEPQLNQPQLTEAELSQTLKHRTFNKSTKLEHVLYD
VRGPVVEEANRMEANGTHILKLNIGNPAPFGFRAPDEVIYDMQQQLIDCEGYSDSRGLFS
ARKAIMQYDQLKGIPGVQMEDIYTGNGVSELINLSMQALLDCGDEILIPSPDYPLWTACA
SLAGGTPVHYMCDEKSHWYPDIADIRSKITPRTKAIVIINPNNPTGVLYSREVLEEIVKI
AREFNLIIFADEIYDRLVMDGKKHISIASLAPDVFCVTFSGLSKSHMIAGFRIGWMSLSG
DKSKARDYIMGLNMLSNMRLCSNVPAQSIIQTALGGYQSVEKYLEPGGRVYEQREYCYNA
LQEMDGVSVERPDAAFYMFVKLDPSRYNIHDDEQFALDLLRDQKLLIVHGKGFNWQTPGY
FRVVYLPRLQTLRDAMGKLANFLSYYRQ
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcacagaattttgctgatgagcttaaaaaagctatgaagcgtaaggggtacaagcag
attgacgtaatcgagcttgcagcaaaaaacggtcataaacttggtaaaagccagttaagc
cagtatttaagcggcaaaaccgagcctcgcaaagacgtacgtaacatgctagctgaaatt
cttggaatcagcagcgacggaatcaaaggcggtcattcttgtgcaaaaatcgagcaaaac
tgccagtctgcagaagaaccacaattaaatcagccacagcttacagaagctgaactttcc
caaacactcaaacatagaaccttcaacaaatcaaccaaactcgagcacgtgctttatgac
gttcgcggcccagttgttgaagaagcaaaccgcatggaagcgaacggaacgcatattcta
aagctcaacattggaaatcctgcgcctttcggattccgcgctccagacgaagtgatttac
gacatgcaacagcagcttattgactgcgaaggctactcggatagtcgtggacttttctcc
gctcgcaaggcgattatgcaatacgatcagcttaagggcattccaggcgtgcaaatggaa
gatatttacactggaaacggagtttccgagctgattaatctttctatgcaagcgctgctt
gattgcggcgacgagattcttatcccaagcccagactatccgttgtggactgcgtgcgct
agcctggctggaggtactcctgtgcactacatgtgtgacgaaaagtcgcattggtaccca
gatattgccgacattcgctctaaaatcacgcctcgcactaaagcaatcgtgattattaac
ccgaataatcctacgggtgtgctgtatagtcgcgaagttttggaagagattgttaagatt
gcgcgcgagtttaatttgattatttttgcggacgagatttacgaccgtcttgttatggat
ggcaagaagcatatttcgattgcttctcttgctccagacgtattctgcgtaactttcagc
ggactttctaagtcgcatatgattgctggcttccgtattggttggatgagtctttcggga
gataaatccaaggctcgcgactacattatgggtcttaatatgctgtctaatatgcgcttg
tgctcgaacgttcctgcgcagtcaattattcagactgctttgggcggataccagagcgtt
gaaaagtatttggaaccaggcggacgcgtgtatgagcagcgcgagtattgctataacgcg
cttcaagagatggatggcgtaagcgttgagcgaccagacgctgctttctacatgtttgta
aagctcgatccaagtcgatacaacattcacgacgacgaacagtttgcgcttgatttgcta
cgcgatcagaagttgctgattgtgcacggcaaaggctttaattggcagactccaggctac
ttccgcgtagtctacttgccgcgcttgcaaacgcttcgtgacgcaatgggcaaactcgct
aacttcctctcctactatcgccagtag

DBGET integrated database retrieval system