KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20237Help
Entry
HMPREF0421_20237  CDS       T01344                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gvg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0421_20237 (malQ)
Enzymes [BR:gvg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     HMPREF0421_20237 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(272628..274877)
Genome map
AA seq 749 aa AA seqDB search
MSTTDNAKTKAATPVPVEESTERLNRPLIQLAKACGVATFYIDQLGDYTEITDEALVGVL
DALGWQADTEENIANSLKRVQEKRDSELLPPTVVCFNGTKTIVPVHTGGSAIDPSKIHVT
LTLEDGTEYEDTPDKPLNNFKTSKEGDLLLELPEDLPMGYHTLKATVDDECALHAQVTLI
SAPARIPLPQSVQERHRWGYMTQLYSVRSKESWGVGDYGDLRRLLKDAGSIGKADFMLIN
PIHACAPVAPLEPSPYLPESRRFLNVTYIRPQDIPEYTQLSDSQREQVEALHESVEAQNN
DPNPMDINAAWSAKLPALKIIFEQPRSAEREQDFADFKARSGEDLDAFATWCVAFEVWGA
PWGDNLWFDTTGKGTPQIDALKCEHADLLEFHRWLQWIADEQVAAAHAEAKAAGMAIGLM
QDMAVGVHGYGADVWWSPERFANGVSVGAPPDFYNQQGQDWGQPPFDPNYLDETGYIAYR
DMVHNVFLHAGAVRIDHVLGLFRLWWIPQGQGAKNGAYVYYNVDAMLAVLSIEATRAGGL
VIGEDLGTVPAYVSKVLASHGILGTVVEWFTHDDDAEKAAKKAGKKQTIFANPSTYREYA
LASVTTHDMPPTAGYLAFEHVKLREELHLLTDSVESFQKAASAERDAMMKMLLEGGWISK
DAAEHVEDHVQEIVEAMHAVMRTSPSLLLQVALVDAVGEKRSQNQPGTSTEYPNWRIPLA
DKDGNVVHTDEVFKSPRVLSMAAVMNGKK
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaacagacaacgccaaaacaaaggctgccacgcctgtgcccgtagaagaaagc
acagaacgactcaatcgtccactaattcagttagcaaaagcctgcggagttgcaactttc
tacatcgaccaactaggcgactatacggaaattaccgatgaagctcttgttggcgtgcta
gatgcactaggttggcaagcagatacagaggaaaatattgcaaactcactaaaacgagtg
caagaaaagcgagatagcgaacttctgccaccaacagttgtatgctttaatggcacaaaa
acaatagtgcctgtgcacactggcggtagtgcaatcgacccaagcaaaatccacgtaaca
ctgactttagaagacggaacagaatacgaggatacgcctgataagccgcttaataacttt
aagacaagcaaagagggcgacttattgctggaacttccagaagatttgccaatgggttac
cacactctgaaagcaactgtagatgacgaatgcgccttgcatgctcaggttacactgatt
tctgctccagcaagaatccctcttccgcaaagcgttcaggaacgccatcgctggggttac
atgactcagctctactccgtgcgatcaaaggaatcttggggagttggcgattatggagac
ttgcgtaggctgcttaaagacgcgggtagcattggcaaagccgacttcatgcttataaac
ccaattcacgcctgcgcaccagtggcgcctttagagccttcgccttatttgcctgagtcg
cgcagattcttaaacgtaacttatattcgcccacaggatattccagaatacacgcaatta
agcgatagccagagagaacaagtggaagctctgcacgagtcggttgaagcgcaaaacaac
gatccaaatcctatggatattaacgctgcttggagcgcaaagctaccagcactaaagata
atttttgagcagcctagaagcgcagagcgtgagcaggatttcgcagactttaaggcgcgt
tctggagaagacttagacgcttttgcgacttggtgcgtagccttcgaggtttggggcgct
ccttggggagataacctttggtttgataccactggcaagggcactcctcagattgacgcg
cttaagtgcgagcacgctgatttgttggagttccaccgctggctgcagtggattgcagac
gagcaggttgcagctgcccacgccgaagctaaagccgctggaatggcaataggtcttatg
caagacatggctgttggcgttcacggctatggcgcagatgtgtggtggagcccagagcga
tttgctaacggcgttagcgttggtgcacctccagacttctacaaccagcaaggtcaggat
tggggtcagcctccatttgaccctaattatctagacgaaactggttacattgcataccga
gacatggttcacaacgtgttcttgcatgctggcgcggttcgcattgaccacgtgctcggg
cttttccgcttatggtggattccgcaaggtcaaggagctaaaaacggtgcttacgtgtac
tacaacgtggacgctatgcttgctgtgcttagcattgaggcgactcgcgcaggcggattg
gtgattggcgaagatttgggcactgttccagcatatgtttctaaggttcttgcctcgcac
ggaattcttggaactgttgttgaatggttcactcacgacgacgatgcagaaaaagccgct
aagaaggctggtaaaaagcagactatatttgcaaacccttccacataccgcgaatacgct
ttggcatctgttacaactcacgacatgccacctacagctggataccttgctttcgagcat
gttaagcttcgcgaggagcttcatttgcttaccgattctgtagaaagcttccagaaggct
gcgagcgcagaacgagacgccatgatgaagatgcttttggaaggcggatggattagcaag
gatgctgccgaacatgtagaagaccatgtgcaagagattgtggaggctatgcatgcggtt
atgcgcacttccccatctttgcttttgcaagtggcgcttgttgacgcagttggagaaaag
cgttcgcagaatcagcctggaaccagtacagaatatccaaattggcgtattcctcttgct
gataaagatggcaatgttgttcataccgacgaagtgtttaagtcacctagagtgctttct
atggcagctgttatgaacggcaaaaaataa

DBGET integrated database retrieval system