KEGG   Gloeobacter violaceus: gll2643Help
Entry
gll2643           CDS       T00148                                 

Definition
ammonium transporter
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
gvi  Gloeobacter violaceus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:gvi00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
complement(2798589..2799443)
Genome map
AA seq 284 aa AA seqDB search
MAPVQRSPEYLLEVARRTAWGAADILLDYYRRPLKIRQKNGGPVTDADLAADRFILSELR
SACGNEAFAYLSEETIGGLERFERPFLWVVDPLDGTRDFIDHTGEFAVHIALVESGRPVL
AAVAWPVRERVYFARKGCGAYSENRAGVRERLQVSQISQLDQCRIIVSRVHRDWRLDALL
ARLPKRERIVHGGLGCKLCAIAAGEAEMYVGLSGRSAPCDWDLAAPQIVLTEAGGAMSRF
DGGDLLYNQPDLHLWGGLIADNGVTHGSWCKLLPDVLSQVEQLD
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggctcccgtgcaaaggtcacccgaatatctgcttgaagtggcccggcgcacggcttgg
ggggcggcggatattttgttggactattacaggcgaccgctcaagattcgccagaaaaac
ggcggcccagtcaccgacgcggatctggccgccgaccgctttattttgagtgagttgcgc
tctgcctgcggcaacgaagcgtttgcgtatttgagtgaggagacgatcggtggtctggag
cgcttcgagcgcccctttttgtgggtagtggatccgctcgacgggacgcgcgattttatc
gaccacacgggcgaatttgctgtgcacatcgcgctggtggaatcgggccggccggtcctg
gcggcggtggcctggccggtgcgcgagcgcgtctactttgcccgcaaagggtgcggggct
tactctgagaaccgcgccggggtgcgcgaacgcctacaggtcagccagatcagccagctc
gaccagtgccggattatcgtgagccgcgtccaccgcgactggcggctcgacgcgctgttg
gcgcggttgccgaaaagggagcgcatcgtccacggtggcttgggctgcaagctgtgcgcc
atcgccgcaggtgaggcggagatgtacgtggggctttcggggcgcagcgccccatgcgac
tgggatctggcagcaccgcagatcgtcttgaccgaggcgggcggtgcgatgagccgtttc
gacggcggcgatttgctctacaaccagccggacttgcacctgtggggcggtctgattgcc
gacaacggtgttacccacggcagttggtgcaagctgttgccggatgtgctctcccaggtc
gaacaactagattga

DBGET integrated database retrieval system