KEGG   Gluconacetobacter xylinus: GLX_05640Help
Entry
GLX_05640         CDS       T01631                                 

Definition
phosphomannomutase
Orthology
K01840  
phosphomannomutase [EC:5.4.2.8]
Organism
gxy  Gluconacetobacter xylinus
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:gxy00051]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gxy00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
658308..659714
Genome map
AA seq 468 aa AA seqDB search
MTFQHRFDPSTLREYDIRGVVGTTLGPEDAYAIGRTFGSMVARAGGQRLIIGRDGRLSSP
SLEQALVEGAVASGMAVQRIGCGPTPMLYFASVAFGADGAIMVTGSHNPPDHNGFKILQA
NQPFFGPQVRELGRLSAMGDVVPHNPGTTQDVDIRPDYVARLLRDYDDGPRPLKVVWDNA
SSAAGDVLSMVVQRLPGTHHILNGTIDGHFPAHHPDPTIPANMRQLADAVRMEKADLGLA
FDGDADRLGVVDDTGTMIWADQLLVLVARDVLRARPGATVIADVKASQILFDEIARAGGR
PLMWKSGHSPIKTKMAETRAPLAGEMSGHFFFADRWYGFDDGLYAAIRLLGIVSRLSQPL
SAIRAALPATLSTPELRFDCPETRKFGVIAEVASRLEKTGATVCAIDGVRVSTGEGWWLL
RASNTQALLVARVEGATQAALERLKAELCAQLALSGIAAPDFSGARSD
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaccttccagcaccggttcgatccctccaccctgcgggaatatgacatccgcggggtt
gtgggaacaacccttggcccggaagacgcctatgccatcggccgcaccttcggcagcatg
gtggcacgggcgggtggtcagcgccttatcatcggtcgtgacgggcggctttcttctcct
tcccttgagcaagcgcttgtggaaggggcggtggcatctggcatggcggtgcagcgtatt
ggctgcgggccaacgcccatgctgtatttcgcctcggtcgcctttggggccgacggggca
atcatggttacgggtagccataaccccccagaccataatggcttcaagatcctgcaggcc
aaccagcctttctttggcccgcaggtcagagaactggggcgactgtccgccatgggcgat
gtcgtgccgcacaaccccggcaccacgcaggatgtggacataaggcccgattatgtcgcg
cgcctcctgcgcgattacgatgatggcccgcgcccgctgaaagtggtgtgggataatgcc
agcagtgcggcaggcgatgtcctttccatggtcgtgcaaagacttcccggcacgcaccat
atcctcaacggcacgatcgacggccattttcccgcacatcaccccgatcccaccattcct
gccaacatgcgccagttggccgatgccgtacggatggaaaaggcagaccttggcctggcg
ttcgatggcgatgccgaccgtctgggcgtggtggatgatacaggcaccatgatatgggcc
gaccagttgctggtgcttgtggcgcgcgacgtgctgcgtgcccggccgggggccacggtc
attgccgatgtcaaggcaagccagatcctgtttgatgagattgcacgcgcaggcggcagg
ccgctcatgtggaaatctggccattcccccatcaagaccaagatggccgagacgcgcgcc
ccgttagcgggcgaaatgtcgggccatttcttttttgccgacaggtggtacggatttgat
gacgggctttatgccgccatccggctgctgggcattgtctcgcgcctgtcacaaccgcta
tcggccatacgtgcggcactccctgccacgctgtccacacccgaactgcgttttgactgc
cccgaaacacgcaaattcggcgtaattgcggaagttgcctcccgtctggaaaaaaccgga
gccacggtctgcgccattgatggcgtgcgtgtctcgacaggggaggggtggtggctgctg
cgcgcctccaacacgcaggcccttctggtcgcgcgggtggaaggagccacgcaggccgcg
ctggaacggctcaaggcggaactctgtgcccagcttgcattgtcgggcattgccgcgcct
gatttttccggggcgagaagcgactga

DBGET integrated database retrieval system