KEGG   Gluconacetobacter xylinus: GLX_27990Help
Entry
GLX_27990         CDS       T01631                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
gxy  Gluconacetobacter xylinus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gxy00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:gxy00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3121182..3121655
Genome map
AA seq 157 aa AA seqDB search
MPWWPVRDRWRRAGIGSGPAGQGILRFVSIAVLERQLDMMELTKRNVLHLHLHLSDGQGF
RVESHLFPRLQQVAGAEQYYTQQQAKALVAYVTQRGIRIVPEFERRVTAKPCCVPTRSLP
PAVPCWRSGPCPARRGPAAGHTPPGIAALVGAVTPGG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgccatggtggcccgtccgggaccggtggcgcagggcaggaataggcagcggccctgcg
ggtcagggcattttgcggttcgtgtcgattgcggttcttgagcggcaactggacatgatg
gaactcaccaagcgcaatgtcctgcacctacacctgcacctgtccgacgggcagggattc
agggtggaaagccatctgttcccgcgcttgcagcaggttgcgggggcagagcagtattat
acccaacagcaggcgaaggctttggtggcatacgtgacacagcgcggtatccgcatcgtg
ccggagtttgaacgccgggtcacagctaagccatgctgtgtgcctacccgcagtttgcca
cccgccgttccatgctggcggtcagggccatgcccagcccgtaggggacctgctgcaggc
cataccccccccggtatagccgcgctggtgggcgcagttacgcccggcggttag

DBGET integrated database retrieval system