KEGG   Gluconacetobacter medellinensis NBRC 3288: GLX_27990Help
Entry
GLX_27990         CDS       T01631                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
gxy  Gluconacetobacter medellinensis NBRC 3288
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GLX_27990
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    GLX_27990
Enzymes [BR:gxy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     GLX_27990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3121182..3121655
Genome map
AA seq 157 aa AA seqDB search
MPWWPVRDRWRRAGIGSGPAGQGILRFVSIAVLERQLDMMELTKRNVLHLHLHLSDGQGF
RVESHLFPRLQQVAGAEQYYTQQQAKALVAYVTQRGIRIVPEFERRVTAKPCCVPTRSLP
PAVPCWRSGPCPARRGPAAGHTPPGIAALVGAVTPGG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgccatggtggcccgtccgggaccggtggcgcagggcaggaataggcagcggccctgcg
ggtcagggcattttgcggttcgtgtcgattgcggttcttgagcggcaactggacatgatg
gaactcaccaagcgcaatgtcctgcacctacacctgcacctgtccgacgggcagggattc
agggtggaaagccatctgttcccgcgcttgcagcaggttgcgggggcagagcagtattat
acccaacagcaggcgaaggctttggtggcatacgtgacacagcgcggtatccgcatcgtg
ccggagtttgaacgccgggtcacagctaagccatgctgtgtgcctacccgcagtttgcca
cccgccgttccatgctggcggtcagggccatgcccagcccgtaggggacctgctgcaggc
cataccccccccggtatagccgcgctggtgggcgcagttacgcccggcggttag

DBGET integrated database retrieval system