KEGG   Geobacillus sp. Y412MC61: GYMC61_0018Help
Entry
GYMC61_0018       CDS       T01101                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GYMC61_0018 (recR)
DNA repair and recombination proteins [BR:gyc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      GYMC61_0018 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
28020..28616
Genome map
AA seq 198 aa AA seqDB search
MHYPEPLSKLIDSFMKLPGIGPKTAARLAFHVLAMKEDTVLEFAKALVDVKRHIHYCTIC
GHITDTDPCYICKDERRDRTTICVVQDPKDVIAMERMKEYNGLYHVLHGAISPMEGIGPE
DIKIAELLTRLQDETIQEVILATDPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaaccgctatcgaagttgattgacagttttatgaaactgcccggcatc
ggcccgaaaacggctgcccgccttgcatttcatgtgctggcgatgaaagaagacaccgtg
cttgagtttgccaaagcgctcgttgatgtcaagcggcatattcattattgcacgatttgc
ggacatattacagatacagacccttgctacatctgcaaagacgagcggcgcgaccggacg
acgatttgcgttgttcaggatccgaaagatgtcatcgccatggagaggatgaaagaatac
aatggcctgtaccacgtgttgcacggggccatctcgccgatggaaggcatcggaccggaa
gatattaaaatcgccgagctgctcacgcgattgcaggatgagacgatccaagaggtgatt
ttagcgaccgacccgaacatcgagggagaggcaacggcgatgtacatctcccgcctgttg
aagccgacaggaatcaaagtcacccgcatcgcccatggcttgccggtcggcggcgacttg
gagtatgcggacgaagtgacgttatcaaaggcgttggaagggcgccgtgagctatag

DBGET integrated database retrieval system