KEGG   Geobacillus sp. Y412MC61: GYMC61_0534Help
Entry
GYMC61_0534       CDS       T01101                                 

Definition
(GenBank) glycoside hydrolase family 2 TIM barrel
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00052  Galactose metabolism
gyc00511  Other glycan degradation
gyc00600  Sphingolipid metabolism
gyc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    GYMC61_0534
  Lipid metabolism
   00600 Sphingolipid metabolism
    GYMC61_0534
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    GYMC61_0534
Enzymes [BR:gyc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     GYMC61_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N DUF4981 Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: ACX77216
JGI: GYMC61_0534
Position
533614..536655
Genome map
AA seq 1013 aa AA seqDB search
MKKTLTTPTLEWLSDPRVFGVNRLPAHSDHIYYETLEEAKNGVSMSMRYELNGNWKFHYA
VNPASRPAKFYQLDFDCSNWGDISVPGHIQLQGYGTPQYVNTMYPWDGHCDARPPEVPMD
YNPVGSYIKIFNLPERMKGKPVYISFQGVESAFYVWLNGQFVGYSEDSFTPAEFELTPFI
KDGENKLAVEVYQYSTGSWLEDQDFWRFSGIFRDVYLYTVPDIHVYDLHVRAELDSSYTR
GMLTADLTFLSPVPAGSRFIAELYDAKGDLVAKKDGELHSEKGTFSIAVDEPELWSAEKP
YLYKLYIQIFNEFGQLVEVVPQKVGFRRFEIINKVMHLNGKRIVFKGVNRHEFHCRRGRA
ITKEDMLWDIKTLKRHNINAVRTSHYPNQSYWYELCDEYGIYVINEMNLETHGTWQKMGR
VDPTWNVPGNNREWQDIVMDRAISMFERDKNHPSILIWSCGNESYAGEVLLNVANYFRSV
DPSRLVHYEGVFHAREYNDISDIESRMYAKPHEIEKYLTENPDKPYISCEYMHAMGNSLG
GMYKYTDLEQKYPMYQGGFIWDFIDQALVKKDRYGKEFLAYGGDFGDRPTDYGFCTNGIV
YANRELSPKMQEVKYLYQNFKLSPDQYGVNIRNESLFTDTSEYDLEYVLFLEGRELYRSK
LNVSVAPQEEKRVEFDWPLGMMADAGEYCIHASFKLKEKTLWADAGYEVAFGQFVFQIGS
KEFVVPSGKLKVVHGDVNIGVHGKDFTIMFSKQAGSLVSMNYAGKEMIAAPPAPLFWRAT
TDNDRGFLQDFYSGLWYAASLARKCVKVDVKEEAAQVNVTFTYKFSINPELEVKIGYTVY
ADGSIRVKVVYHGVENLPSMPIFAVSFKVPADYNQLEWYAMGPEENYVDRSKGARLGIFR
NQVSDNVSRYLKPQESGNRTGVRKVSLTNNNGQGIKISSITEPLECNFSPYTAFELEHAN
HHYELPNIHYTVVTVAGRQMGVGGDDSWGAPVHDEYVIKADQDMEFEFVIHKV
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacattaacaacccccacattagaatggctttcggatcctcgtgtgttcggg
gttaatcgcctgcctgcccattcggaccatatttattatgagacgttggaagaagcaaaa
aatggagtttccatgtcgatgcgctatgagttaaatggaaattggaagtttcactatgcg
gtcaatccagctagccgtcccgcgaaattttatcaacttgattttgactgctcaaactgg
ggcgatatttccgtaccagggcatattcagttgcaaggctatggaactccccagtatgta
aatacgatgtatccgtgggacggtcattgcgatgctcgtcctccagaagttcctatggat
tataatccagtaggaagctatataaaaatttttaatcttcctgaacgtatgaaagggaaa
ccggtgtatatttcttttcaaggagtggagtcggcgttttatgtttggttgaacgggcag
tttgtcgggtatagtgaggactctttcacgccggcagaatttgaacttacaccttttata
aaggatggagagaataagctcgcggttgaggtttaccagtacagcaccggaagttggctt
gaggatcaggatttctggcgtttttctggaatctttcgcgatgtatacctttatacagtg
ccagatattcatgtctatgatttacatgttcgcgccgaattggattcgtcctatacgaga
ggcatgttaacggcggaccttacctttttgtctccggtacctgccggctctaggtttatc
gctgaactgtatgatgcgaaaggcgaccttgtcgccaaaaaagacggagagcttcatagc
gaaaaggggacattttccattgcggtcgatgaaccggaattatggagcgcggagaaaccg
tatttgtataagctatatattcagatttttaacgagtttggccaattggtagaggttgtt
ccacagaaggtcggttttcgaagattcgagatcatcaataaagttatgcaccttaacgga
aaacggattgtatttaaaggcgttaaccgacatgaatttcattgccgaagaggccgggcg
atcacaaaggaagatatgctatgggatattaaaacattgaagcgtcataacattaacgca
gtccgtacgtcacactatccgaatcaaagctattggtatgaactatgcgatgaatacggc
atctatgtcattaatgaaatgaatttggaaacgcacggaacgtggcaaaaaatgggccgt
gtcgaccccacatggaatgttccagggaacaatcgagaatggcaagacattgttatggac
cgggcgatttcaatgtttgaaagggataagaaccatccttccatcctgatttggtcatgt
ggaaatgaatcgtatgctggggaagttctgttaaacgtcgccaactattttcggtcagtc
gatccgagccgtcttgtccattatgaaggagtattccatgcccgcgagtacaatgatata
agcgacatagaaagtcgtatgtacgcaaagcctcatgaaattgaaaagtatttaacagaa
aatccggataaaccatatatcagctgcgaatatatgcatgcaatggggaactcgctcggc
gggatgtacaaatatacggatttggaacaaaagtatccgatgtatcaaggtggttttatt
tgggatttcattgatcaagcccttgtgaaaaaagatcgttatggaaaagaatttttggca
tatggaggggactttggcgaccgtccaaccgattacggtttctgtacgaacggaattgtc
tatgccaaccgggagttgtcaccgaagatgcaggaagtaaaatatctttatcaaaacttt
aagctttcaccggatcaatacggtgtcaatattagaaatgaaagtcttttcactgacaca
agtgaatatgatttagaatacgtcctattccttgaagggagagagttgtatcgaagcaag
ctgaatgtatcggtagcaccgcaggaagagaaaagagtcgagttcgactggccccttggg
atgatggcagatgcaggtgaatattgcattcatgcatcatttaaattgaaagaaaaaaca
ctttgggctgatgctggttatgaggtggcattcggccagtttgtattccagattggttcc
aaggaattcgttgttcctagcggaaagttaaaagttgtccatggtgatgtcaacattggg
gtgcacggcaaagattttacgatcatgttttccaaacaggcaggaagcctagtttcaatg
aattacgcaggcaaggagatgattgcggcccctcctgcaccattgttttggagggccacg
actgataatgaccgaggttttttgcaagacttctattcggggctttggtatgcggcgagt
ttggcgcgtaaatgtgtaaaagtcgatgtgaaagaggaagcggcccaagtaaatgtcacc
tttacctacaaattttccattaaccccgaattggaagtgaaaattggttataccgtttat
gctgatggcagcattcgcgtgaaggtggtctatcatggagtcgagaatcttccgtcaatg
ccgatttttgcggtatcattcaaggttccagccgactataatcaactcgagtggtatgca
atggggcccgaagaaaactatgtcgatcgctcaaagggggcaagacttggaatttttaga
aatcaagtatctgacaatgtatcgcgctatctcaaaccgcaggaatcaggaaacagaaca
ggtgttcgtaaagtaagcttaacgaacaacaatggacagggaataaaaatttcttctata
actgaaccgttggaatgcaacttttcgccatacacagcttttgaacttgaacatgccaat
catcattacgagctgcccaatattcattatacggttgtcacggtagcaggtcgacaaatg
ggagttggcggggacgacagctggggcgccccagttcacgatgaatacgtcataaaggca
gatcaagacatggaatttgagtttgtgattcataaagtttag

DBGET integrated database retrieval system