KEGG   Geobacillus sp. Y412MC61: GYMC61_0534Help
Entry
GYMC61_0534       CDS       T01101                                 

Definition
glycoside hydrolase family 2
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gyc00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:gyc00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:gyc00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
533614..536655
Genome map
AA seq 1013 aa AA seqDB search
MKKTLTTPTLEWLSDPRVFGVNRLPAHSDHIYYETLEEAKNGVSMSMRYELNGNWKFHYA
VNPASRPAKFYQLDFDCSNWGDISVPGHIQLQGYGTPQYVNTMYPWDGHCDARPPEVPMD
YNPVGSYIKIFNLPERMKGKPVYISFQGVESAFYVWLNGQFVGYSEDSFTPAEFELTPFI
KDGENKLAVEVYQYSTGSWLEDQDFWRFSGIFRDVYLYTVPDIHVYDLHVRAELDSSYTR
GMLTADLTFLSPVPAGSRFIAELYDAKGDLVAKKDGELHSEKGTFSIAVDEPELWSAEKP
YLYKLYIQIFNEFGQLVEVVPQKVGFRRFEIINKVMHLNGKRIVFKGVNRHEFHCRRGRA
ITKEDMLWDIKTLKRHNINAVRTSHYPNQSYWYELCDEYGIYVINEMNLETHGTWQKMGR
VDPTWNVPGNNREWQDIVMDRAISMFERDKNHPSILIWSCGNESYAGEVLLNVANYFRSV
DPSRLVHYEGVFHAREYNDISDIESRMYAKPHEIEKYLTENPDKPYISCEYMHAMGNSLG
GMYKYTDLEQKYPMYQGGFIWDFIDQALVKKDRYGKEFLAYGGDFGDRPTDYGFCTNGIV
YANRELSPKMQEVKYLYQNFKLSPDQYGVNIRNESLFTDTSEYDLEYVLFLEGRELYRSK
LNVSVAPQEEKRVEFDWPLGMMADAGEYCIHASFKLKEKTLWADAGYEVAFGQFVFQIGS
KEFVVPSGKLKVVHGDVNIGVHGKDFTIMFSKQAGSLVSMNYAGKEMIAAPPAPLFWRAT
TDNDRGFLQDFYSGLWYAASLARKCVKVDVKEEAAQVNVTFTYKFSINPELEVKIGYTVY
ADGSIRVKVVYHGVENLPSMPIFAVSFKVPADYNQLEWYAMGPEENYVDRSKGARLGIFR
NQVSDNVSRYLKPQESGNRTGVRKVSLTNNNGQGIKISSITEPLECNFSPYTAFELEHAN
HHYELPNIHYTVVTVAGRQMGVGGDDSWGAPVHDEYVIKADQDMEFEFVIHKV
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacattaacaacccccacattagaatggctttcggatcctcgtgtgttcggg
gttaatcgcctgcctgcccattcggaccatatttattatgagacgttggaagaagcaaaa
aatggagtttccatgtcgatgcgctatgagttaaatggaaattggaagtttcactatgcg
gtcaatccagctagccgtcccgcgaaattttatcaacttgattttgactgctcaaactgg
ggcgatatttccgtaccagggcatattcagttgcaaggctatggaactccccagtatgta
aatacgatgtatccgtgggacggtcattgcgatgctcgtcctccagaagttcctatggat
tataatccagtaggaagctatataaaaatttttaatcttcctgaacgtatgaaagggaaa
ccggtgtatatttcttttcaaggagtggagtcggcgttttatgtttggttgaacgggcag
tttgtcgggtatagtgaggactctttcacgccggcagaatttgaacttacaccttttata
aaggatggagagaataagctcgcggttgaggtttaccagtacagcaccggaagttggctt
gaggatcaggatttctggcgtttttctggaatctttcgcgatgtatacctttatacagtg
ccagatattcatgtctatgatttacatgttcgcgccgaattggattcgtcctatacgaga
ggcatgttaacggcggaccttacctttttgtctccggtacctgccggctctaggtttatc
gctgaactgtatgatgcgaaaggcgaccttgtcgccaaaaaagacggagagcttcatagc
gaaaaggggacattttccattgcggtcgatgaaccggaattatggagcgcggagaaaccg
tatttgtataagctatatattcagatttttaacgagtttggccaattggtagaggttgtt
ccacagaaggtcggttttcgaagattcgagatcatcaataaagttatgcaccttaacgga
aaacggattgtatttaaaggcgttaaccgacatgaatttcattgccgaagaggccgggcg
atcacaaaggaagatatgctatgggatattaaaacattgaagcgtcataacattaacgca
gtccgtacgtcacactatccgaatcaaagctattggtatgaactatgcgatgaatacggc
atctatgtcattaatgaaatgaatttggaaacgcacggaacgtggcaaaaaatgggccgt
gtcgaccccacatggaatgttccagggaacaatcgagaatggcaagacattgttatggac
cgggcgatttcaatgtttgaaagggataagaaccatccttccatcctgatttggtcatgt
ggaaatgaatcgtatgctggggaagttctgttaaacgtcgccaactattttcggtcagtc
gatccgagccgtcttgtccattatgaaggagtattccatgcccgcgagtacaatgatata
agcgacatagaaagtcgtatgtacgcaaagcctcatgaaattgaaaagtatttaacagaa
aatccggataaaccatatatcagctgcgaatatatgcatgcaatggggaactcgctcggc
gggatgtacaaatatacggatttggaacaaaagtatccgatgtatcaaggtggttttatt
tgggatttcattgatcaagcccttgtgaaaaaagatcgttatggaaaagaatttttggca
tatggaggggactttggcgaccgtccaaccgattacggtttctgtacgaacggaattgtc
tatgccaaccgggagttgtcaccgaagatgcaggaagtaaaatatctttatcaaaacttt
aagctttcaccggatcaatacggtgtcaatattagaaatgaaagtcttttcactgacaca
agtgaatatgatttagaatacgtcctattccttgaagggagagagttgtatcgaagcaag
ctgaatgtatcggtagcaccgcaggaagagaaaagagtcgagttcgactggccccttggg
atgatggcagatgcaggtgaatattgcattcatgcatcatttaaattgaaagaaaaaaca
ctttgggctgatgctggttatgaggtggcattcggccagtttgtattccagattggttcc
aaggaattcgttgttcctagcggaaagttaaaagttgtccatggtgatgtcaacattggg
gtgcacggcaaagattttacgatcatgttttccaaacaggcaggaagcctagtttcaatg
aattacgcaggcaaggagatgattgcggcccctcctgcaccattgttttggagggccacg
actgataatgaccgaggttttttgcaagacttctattcggggctttggtatgcggcgagt
ttggcgcgtaaatgtgtaaaagtcgatgtgaaagaggaagcggcccaagtaaatgtcacc
tttacctacaaattttccattaaccccgaattggaagtgaaaattggttataccgtttat
gctgatggcagcattcgcgtgaaggtggtctatcatggagtcgagaatcttccgtcaatg
ccgatttttgcggtatcattcaaggttccagccgactataatcaactcgagtggtatgca
atggggcccgaagaaaactatgtcgatcgctcaaagggggcaagacttggaatttttaga
aatcaagtatctgacaatgtatcgcgctatctcaaaccgcaggaatcaggaaacagaaca
ggtgttcgtaaagtaagcttaacgaacaacaatggacagggaataaaaatttcttctata
actgaaccgttggaatgcaacttttcgccatacacagcttttgaacttgaacatgccaat
catcattacgagctgcccaatattcattatacggttgtcacggtagcaggtcgacaaatg
ggagttggcggggacgacagctggggcgccccagttcacgatgaatacgtcataaaggca
gatcaagacatggaatttgagtttgtgattcataaagtttag

DBGET integrated database retrieval system