KEGG   Geobacillus sp. Y412MC61: GYMC61_2939Help
Entry
GYMC61_2939       CDS       T01101                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYMC61_2939
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYMC61_2939
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GYMC61_2939
Enzymes [BR:gyc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GYMC61_2939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2996266..2997429)
Genome map
AA seq 387 aa AA seqDB search
MSVAQEKKGYFGEFGGSFVPPELQEVLDYLEEQFLKYKDDPEFNEEFRTYLREYVGRESP
LTFAARLTERLGGAKIYLKREDLNHTGSHKINNVIGQILLAKRMGAKRVIAETGAGQHGV
ATATACAMFGMDCTIYMGVEDTKRQALNVFRMELLGAKVVLVSKGQGRLKDAVDEALNDL
VQNYKTTFYLLGSAVGPHPYPSMVKHFQSVISEESKRQILEREGRLPDVVVACVGGGSNA
IGAFAHYLDEPSVRLIGVEPEKAATLTKGVPAVLHGFKCLVLLDENGNPQPTYSIAAGLD
YPGIGPEHSYLKVSGRAEYYTVTNEEVLEAFQLLSKTEGIIPALESAHAVAYAIKLAPTL
SKDHIIIVNLSGRGDKDVEQVFSMLQS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtagcgcaggaaaagaaaggctatttcggcgaatttggcggcagctttgttcca
cctgaactgcaggaagtgcttgactatttggaagagcagtttctgaaatataaagatgac
ccggaattcaatgaggagtttcgaacctacttgcgggagtatgtcggccgcgagagtccg
ctgacgtttgcggcgcgattgacggagcggctcggcggggcgaagatttatttgaaacgt
gaggatttgaaccataccggttcgcataaaatcaacaacgtcatcgggcaaattttgttg
gcgaaacggatgggtgcgaagcgggtcattgcggagacaggcgcgggccagcatggggtg
gcgaccgctaccgcatgcgccatgtttggcatggactgcaccatttatatgggggtagaa
gatacgaagcgtcaggcgctcaacgtgttccgcatggagctgttaggggcgaaagtcgtg
ctggtctcgaaagggcaagggcggttgaaggatgccgtggacgaggcgctgaacgatctt
gtacaaaactataagactacgttttatttgcttggttcggcggttggtccgcatccgtat
ccgtcgatggtgaaacattttcagtcggtgattagcgaagagagcaagcggcaaatttta
gagagagaagggcggcttccggatgtggtggtggcctgcgttggcgggggaagcaacgct
atcggggcgttcgcccattatttggatgaaccgagtgtgcggctcatcggtgtcgagccg
gagaaggcggcgacgttgacgaaaggggttccggcggttcttcacggattcaagtgtctc
gtgttgcttgatgaaaacggcaacccgcagcccacatactcgattgccgctgggctcgat
tatccgggcattggtccggaacatagctacttgaaagtatccgggcgtgcggaatattac
acggtcacgaacgaagaggtgcttgaggcatttcagttgctgtccaaaacggaaggaatc
atcccagcgctcgagagcgcccatgcggtggcgtacgctatcaaactcgcgccgacatta
agcaaagatcacatcatcattgtgaacttatcaggccgcggggataaagacgtcgagcaa
gtgttttcaatgttacagtcataa

DBGET integrated database retrieval system