KEGG   Paenibacillus sp. Y412MC10: GYMC10_2371Help
Entry
GYMC10_2371       CDS       T01100                                 

Definition
Acireductone dioxygenase ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:gym00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2708509..2709045)
Genome map
AA seq 178 aa AA seqDB search
MAEIVIRNTNERITGEENVREFLNNQEVVYEHWNMDKLPADLQENFKLSDEDKQRILDIF
DEEIRDLAARRGYKIWDVITLSESTPNIEDLLKKFEEVHTHSEDEIRAIVGGKGIFIIKG
SDDVGYFNVELEPGDVISVPENTPHFFTLMENKQIIAVRLFIEENGWVATPVEDPQFQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatcgtgattcgcaacacgaacgaacgcattactggggaagaaaatgttcgg
gaattcctgaataaccaagaggttgtttatgagcattggaatatggataaactcccggca
gatcttcaagaaaatttcaagctgagtgatgaagataagcagcgcattttggacattttt
gacgaagaaattcgcgacctggctgcaagacgcggctacaaaatctgggatgtcatcacg
ctttccgagtccacgcccaatatagaggacctgcttaaaaaattcgaagaagttcacacc
cactcggaagacgaaatccgtgcgatcgttggcggcaaagggatcttcattattaaaggc
tccgacgatgtcggttactttaacgtagagcttgagccgggcgacgttatctccgtaccg
gaaaacacgcctcatttcttcacgctgatggagaacaagcagatcatcgcggttcgtctc
tttattgaagagaacggctgggtagctactccggtagaagatccccaatttcaataa

DBGET integrated database retrieval system