KEGG   Paenibacillus sp. Y412MC10: GYMC10_2371Help
Entry
GYMC10_2371       CDS       T01100                                 

Definition
(GenBank) Acireductone dioxygenase ARD
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00270  Cysteine and methionine metabolism
gym01100  Metabolic pathways
Module
gym_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GYMC10_2371
Enzymes [BR:gym01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     GYMC10_2371
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     GYMC10_2371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding
Motif
Other DBs
NCBI-ProteinID: ACX64649
JGI: GYMC10_2371
UniProt: D3E8S2
Position
complement(2708509..2709045)
Genome map
AA seq 178 aa AA seqDB search
MAEIVIRNTNERITGEENVREFLNNQEVVYEHWNMDKLPADLQENFKLSDEDKQRILDIF
DEEIRDLAARRGYKIWDVITLSESTPNIEDLLKKFEEVHTHSEDEIRAIVGGKGIFIIKG
SDDVGYFNVELEPGDVISVPENTPHFFTLMENKQIIAVRLFIEENGWVATPVEDPQFQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatcgtgattcgcaacacgaacgaacgcattactggggaagaaaatgttcgg
gaattcctgaataaccaagaggttgtttatgagcattggaatatggataaactcccggca
gatcttcaagaaaatttcaagctgagtgatgaagataagcagcgcattttggacattttt
gacgaagaaattcgcgacctggctgcaagacgcggctacaaaatctgggatgtcatcacg
ctttccgagtccacgcccaatatagaggacctgcttaaaaaattcgaagaagttcacacc
cactcggaagacgaaatccgtgcgatcgttggcggcaaagggatcttcattattaaaggc
tccgacgatgtcggttactttaacgtagagcttgagccgggcgacgttatctccgtaccg
gaaaacacgcctcatttcttcacgctgatggagaacaagcagatcatcgcggttcgtctc
tttattgaagagaacggctgggtagctactccggtagaagatccccaatttcaataa

DBGET integrated database retrieval system