KEGG   Halophilic archaeon: Halar_0805Help
Entry
Halar_0805        CDS       T01603                                 

Definition
dihydropteroate synthase (EC:2.5.1.15 6.3.2.17)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hah  Halophilic archaeon
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hah00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(81273..83831)
Genome map
AA seq 852 aa AA seqDB search
MHYHEAANFLFDLRRFGVDPGVASVRALVDEVGVDPAPSPGEGPAYVQVAGSNGKGSTAR
MVESALREAGLTVGLYTSPHLEQLTERIRVDGREMPRSAVALFVEQVKPWLIDRAADEDP
LTFFEVVTAMALWRFERADVDVAVLEVGMGGEFDATSVVSPVASAVTNVSLEHTNVLGDS
VVEIARTKSHVAPEGRPLVTGTQDAALRTVREAVDGVVTVGDDQWTGEGATAADAPRPDV
LVEYRGRVDHQHASVGITHAGREDADEGLAAAEWAVDAEIPLLGEHQANNAGVACTLARQ
AGDAVGVEVTETDLERGLARADWPGRFEVMEPEPLTVLDGAHNPDACETVAETLSTFAYD
DCHLVFAAMHDKDASEMAAALPESASVTTCEPAIDRAEDSEVLATVFRNRGAEDVTATGS
VASALSKARKRAGEDDAILLCGSLFAVAEARATWTRLQVPKDVDSIGDAEAVLEDAQVSQ
PGIWRMRGKVDHRVLHTRVQERQAEYLKQEMLSLGGECSASGLRSSGELHDVVLSGTMAQ
FKRLTGKLQGQPWGLTELGEELRTELGIQHSPAEPAYPWNTGGAAVMGVLNVTPDSFHDG
GKYERLADALAQAEAMVEAGADIIDVGGESTRPGADPVEIEEELDRVLPVVEKLNDLDVP
VSVDTRRPEVARAVIDVGADMINDVEGLQNPEMRRLVAETGIPVVVMHSVDVPVDPDRDV
EYDDVVEETVRELNERVLAAEKAGVDREQIIVDPGLGFGKSAAECFEILGRLGEFDALGC
PLLFGHSHKSMFTLTGEEAGEAPNSTIAATALAVANGADIVRIHDVAENAAAVNVADVSE
TGVETESGGDGQ
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgcactaccacgaggccgccaacttcctcttcgacctccggcggttcggcgtcgacccc
ggggtggcgtcggtccgcgcgctggtcgacgaggtgggcgtcgacccagcgccctcgccg
ggtgagggccccgcgtacgtccaagtggccggctcgaacgggaaagggagcaccgctcga
atggtcgagtcggcgctccgtgaggccgggctgacggtcgggctctacacctcaccccac
ctcgaacagctgactgagcgaatccgggtcgacggccgagagatgccccgctctgcggtg
gccttgttcgtcgagcaggtgaagccgtggcttatcgaccgggccgccgacgaggatccg
ctgacgttcttcgaggtcgtgaccgcgatggcgctctggcggttcgagcgcgcggacgtc
gacgtggccgtcctcgaagtcgggatgggcggggagttcgacgccacctccgtcgtttcc
cctgtcgcgagtgcagttaccaacgtctcgctcgaacacacgaacgtcctcggagactcg
gtggtggagattgcgcgcacgaaatcccacgtcgctcccgagggacgcccgttggtcact
gggacgcaggacgcggcgctgcggaccgttcgcgaggcggtcgacggcgtggttaccgtc
ggcgacgaccagtggaccggcgagggggcaacggccgcggacgcaccgcggcccgacgtt
ctggtggagtatcgtggccgagtcgaccaccagcacgcctccgtgggcatcacccacgcc
ggccgagaggatgctgatgagggactcgccgcggcggagtgggccgttgatgccgagatt
ccgttgcttggcgagcaccaggcgaacaatgccggcgtggcctgcacgctcgcccgacaa
gctggggatgccgtaggcgtcgaggtgaccgaaaccgacctcgaacgcgggctggctcgg
gcggactggcccggtcggttcgaggtgatggaaccggagccgctgacggtgctggacggc
gcacacaacccagacgcctgcgagacggtggccgagacgctctcgacgttcgcgtacgac
gactgccacctcgtcttcgcggccatgcacgacaaggacgcctcggagatggcggctgcc
ctccccgagagtgcgagcgtgacgacctgtgagccagcaatcgaccgggcggaggattcg
gaagtgctggcgacggtgttccgcaaccgcggcgccgaggacgtgaccgcgaccggctcg
gttgcgagcgcactctccaaagcccggaagcgtgcgggcgaagacgacgcgattctgctc
tgtggctcgctgttcgccgtcgcggaggcacgggcaacgtggacccggctgcaggtgccc
aaggatgtcgactccatcggcgacgccgaagccgtgctggaggacgcacaggtctcccaa
cccggcatctggcggatgcgcggcaaagtcgaccatcgcgtgctccacacgcgggtccaa
gagcggcaggcggagtacctcaaacaggagatgctctcactgggcggggagtgttcggcg
tcaggattgcgctcgagcggggagctccacgacgtggtgctctctgggacgatggcgcag
ttcaagcgactcaccgggaagctccaaggccagccctgggggctcacagaactgggcgag
gagctccgaaccgaactcgggattcaacacagcccggcagaaccggcgtatccatggaat
accggtggcgctgcggtgatgggcgtgctgaatgtcaccccggattcgttccacgacggc
ggcaagtacgaacggctggcggacgcgctggcgcaggccgaggcgatggtcgaggccggc
gcggatatcatcgacgtaggtggtgagagcacgcgtcccggcgcagaccccgtcgaaatc
gaagaggaactggaccgggtactccccgtggtggagaaactaaacgacctcgacgtgccc
gtctcagtggacacccggcggcccgaggttgcacgggcggtcatcgacgtcggtgcagat
atgatcaacgatgtggagggcctccagaacccggagatgcgccgcctcgtggccgagacc
ggcatcccggtcgtcgtcatgcactccgtcgacgtccccgtggacccggaccgcgacgtg
gagtacgacgatgtggtcgaggagacggttcgggagctgaacgagcgtgtgctcgccgca
gagaaggcaggggtcgaccgcgaacagattatcgtcgaccccggactggggttcggcaag
agcgccgccgagtgtttcgagattcttgggcgacttggggagttcgacgcgctgggctgt
ccgctgttgttcggccactcccacaagtccatgttcacgctgacaggcgaggaggcaggt
gaggcaccgaactccaccatcgcggcgaccgcactcgcggttgccaacggcgcggatatc
gtccgcatccacgacgtggcggagaacgccgcagcagtgaacgtcgcggacgtgagcgaa
actggcgtcgaaaccgagtccggcggtgatggccagtga

DBGET integrated database retrieval system