KEGG   Halophilic archaeon: Halar_3349Help
Entry
Halar_3349        CDS       T01603                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hah  Halophilic archaeon
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halar_3349
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halar_3349
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Halar_3349
Enzymes [BR:hah01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Halar_3349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2551760..2552989)
Genome map
AA seq 409 aa AA seqDB search
MDHVEALSCVLCDETYDPDQLIYTCPNHESVRGILEVVYDYDRVAERFDESMDGRIDSQW
KYRAFLPVADDSTPVTLGEGGTPLLDAPRLGDELGVDLRVKDDGRNPTGVLKDRATAVSL
TKAREFGRNVVTCASTGNAAASLAGYAARGGQDCRLFVPGDAPKGKLAQPLVYGADVLGV
EGSYDEAYDLSMAVTERFGWYNRNAAVNPFQVEGKRTVGHELAEQTQEDLPDWLVFSMGD
GCTIAGGWKGFREFRDLGFVDDAPKMLGVQAHGASAIHDAFQEHDDVDEVADTVADSIAV
GRPRNTVKACMALEESDGDSVLVSDEEILAGEALLGRTEGIYAEPAGAAPVAGVKKAREQ
GIIEPGESVVVVVTGNGLKDTESAMRAAGEVESIAPDIDDVIERYPDEV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggaccacgtcgaggcgctttcgtgcgtgctgtgtgacgagacgtacgaccccgaccag
ctcatctacacctgtcccaaccacgagagcgtcaggggcatcctcgaggtcgtctacgac
tacgaccgtgtcgccgagcgcttcgacgaatcgatggacggacgcatcgactcccagtgg
aagtaccgcgcgttcctcccggtcgctgacgactccaccccagtcaccctgggcgagggt
ggcacccctctcctcgacgcgccgcggctcggcgacgaactcggcgtcgacttgcgggtc
aaggacgacggccgcaaccccaccggtgtgctgaaggaccgcgctaccgccgtctcgctg
accaaggcacgggagttcggccgtaacgtcgtcacctgcgcctcgacgggcaacgcggcg
gcctcgctcgcaggctacgcggcccgcggcgggcaggactgccggctattcgtcccaggc
gacgctcccaaagggaagctcgcccaacccctcgtgtacggtgccgacgtgctcggcgtg
gaggggagctacgacgaggcctacgacctcagtatggcggtgaccgagcggttcggctgg
tacaaccgcaacgccgcggtcaaccccttccaggtggagggaaagcgtacggtcggtcac
gagctcgccgagcagactcaggaggacctgcccgactggctggtgttctcgatgggtgac
ggctgcaccatcgccggcggctggaaggggttccgggagttccgggacctcggattcgtc
gacgacgcgccgaagatgctcggcgtgcaggcccatggcgcgagtgccatccacgacgcg
ttccaggaacacgacgatgtcgacgaggtggcagacaccgtcgccgacagcatcgccgtc
ggtcggccgcgcaacacggtgaaagcctgcatggcgctggaggagagcgatggtgattcg
gtgctcgtgagcgacgaggagatcctcgccggcgaggcgttgctcggccgaaccgagggt
atctacgccgagccggcgggcgcggcacccgtcgctggcgtgaagaaagcccgcgagcag
gggataattgaaccaggcgaatcggttgtcgtcgtcgtcaccggcaacggcctgaaggac
accgagagcgcgatgcgcgcggccggcgaagtcgagtccatcgctcccgatattgacgac
gtgatcgagcgctaccccgacgaggtctga

DBGET integrated database retrieval system