KEGG   Halanaerobium hydrogeniformans: Halsa_0410Help
Entry
Halsa_0410        CDS       T01349                                 

Definition
(GenBank) sodium/hydrogen exchanger
Organism
has  Halanaerobium hydrogeniformans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger DUF2921 BK_channel_a
Motif
Other DBs
NCBI-ProteinID: ADQ13885
UniProt: E4RP60
Position
467755..469044
Genome map
AA seq 429 aa AA seqDB search
MENIIVSSSELYQLEQWLQLNDLQTRAIYLLAFFLLLSLLAVVISKKYSLPIVVGYVLFG
ILISPDILGLLPFLESEFHHWYEFLVFNLDYITQIALAFIVFTIGSELSIRTFKRLGKNI
YLIALFEALAAVIFTALAVYLIGVPAYAAVLLGAIAAASAPASTVMVLKEYNAEGPLSST
LMAVVGLDNTLALIIFGLLSPLSILMIEGGGAFLSIDVLLVPFLNIIAAVVLGLGIGYAA
QHYISYVDDKTKKVISIITAVVLSSALSLFFGLSSLITNLAVGFSIRNFAEKNLQISEYL
DTLTIPLYAMFFIFAGAEIRFSQMASSTFIYTALVFLTVRIIAKVGGAFIAGRISDAHIN
VKKYIGMGLIPQGGVAIALAFSVQKQFSQVPETALLIFNLIILTAAITEIFGPLLTKEAL
IRSGEAEHD
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatataatagtaagctcttctgaactctatcaacttgaacaatggttacagtta
aatgatcttcagacaagggcaatatatctgctggcattctttttacttttatcactactg
gcggttgttatatcaaaaaaatacagtttaccaattgtggttgggtatgttttatttggt
atattaatttcaccggatattctagggcttctaccatttttagaaagtgagtttcatcac
tggtatgagtttttagtttttaacctggattatataacccagatagctctggcctttatc
gtttttaccatcggaagcgaattatcgattcgaacctttaaacgacttggtaaaaacatt
tatttaattgcgttatttgaggccctggccgcggtaatctttaccgctctggcagtttat
ctgatcggagttccagcttatgcagcagtcctgcttggagcaatagcagcagcttcggca
cctgcttcaactgtaatggtgcttaaagaatacaatgcagaaggacctttaagttctacc
ctaatggccgttgttggtttagataataccttagctttgattatctttggacttttaagt
ccactttctatactgatgatcgagggtggaggagcatttttatcgatagatgttttgcta
gttccgtttttaaatattattgctgctgtagtacttggtctgggaataggttatgctgcc
cagcattatattagctatgtagatgataaaacaaaaaaggttatcagtatcatcacagca
gttgttttgagttcagctttaagcctcttttttgggctttcttctttgattaccaacctg
gcggtcggtttttcgatccgtaattttgccgaaaaaaatctccagatatctgagtatctt
gatactcttacaattccattatatgcgatgttctttattttcgcaggtgcagaaattcgt
ttcagtcaaatggcatcttctacctttatctatactgctttagttttccttactgtcaga
attattgccaaagttggcggagcatttattgcaggcaggatttcagatgctcacataaat
gttaaaaaatatattggaatgggattgataccccagggaggggtagcaatagcacttgca
ttttcggtacagaaacagttttcccaggttcccgaaacagctttgttgatttttaattta
atcattttaacagctgccataacagaaatttttggtccgcttctaaccaaagaagctctt
attcgttctggagaagcagaacatgattag

DBGET integrated database retrieval system