KEGG   Halanaerobium hydrogeniformans: Halsa_1302Help
Entry
Halsa_1302        CDS       T01349                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Halsa_1302
Enzymes [BR:has01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Halsa_1302
    3.5.1.-  
     Halsa_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1469143..1469739)
Genome map
AA seq 198 aa AA seqDB search
MKKALLAVDLQNDFYEDGALAVPAASKINQKVNELLESEEYEIIVASQDWHPQNHRSFAS
VHGEKAFTPYDKEEGLGPVLWPDHCVQKSEGAEFNSEVKTHKFDYILRKGTDPEVDSYSA
FQDNDGSDLGLAALLKSFGIEEVDICGLAYDVCVKYTALDSVKNAFKTNIIQAASAAVNP
DEIEKCNQELKQAGVNLI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcattattagccgttgatttacaaaatgacttttatgaagatggggcatta
gctgttccagctgcatctaagataaatcagaaggtaaatgaattactggaatcagaagag
tatgagattattgttgcttctcaagactggcatcctcaaaatcaccgcagttttgcttct
gttcatggtgaaaaagcatttacaccttatgacaaagaagaaggactagggccagttctc
tggcctgatcactgtgtgcaaaaaagtgagggtgcagaatttaacagtgaagttaagacc
cataagttcgattatatacttcgtaaaggaacagatccagaagttgatagttattctgcc
tttcaagacaatgatggtagtgatttaggcttggcagctctactcaagtcttttgggata
gaagaagtagatatttgtggtttagcatatgatgtctgtgtaaaatatactgctcttgat
agtgttaaaaatgcttttaaaacaaatattattcaggcagcttctgcagctgttaatccg
gatgaaatagaaaagtgtaatcaagaactcaaacaagcaggtgttaatttaatttag

DBGET integrated database retrieval system