KEGG   Herpetosiphon aurantiacus: Haur_0084Help
Entry
Haur_0084         CDS       T00614                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hau00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hau00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
109251..110795
Genome map
AA seq 514 aa AA seqDB search
MKSFAELLLHVTHQASGDHHVAISNVAYDSRKVTPGALFVAIKGVHVDGHRYIATALEQG
AVAVVYDDPHQAPPATIPSALVADAKVALSPIAAAFYDYPAQQLEVVGITGSKGKTTTTF
LTAAALEASGELVGFMSTVDFKIGQRQWANKTRQSTPEALEIQAMLREMVEAGCRYAVVE
STSHGLSPRWNRLGDCAYDVALITNVTHEHLDYHGTVEQYRADKAQLFQLLATSPSQKSI
LGQPTPVEKVAIVNADDPHAAQFRAAAGEQVRHLSYAIHAEADLRATEIVSTSKGLRFTA
ITPQGNFALNLQLVGTFYVYNVLAALSVCLARGVDLAAAIQRLEAIPGINGRMEQVELGQ
PFSVLVDYAHNPDSFEQVMSMLRPLTQGRLIAVFGSAGERDLAKRPIQGQIAAKWCDLLY
LTDEDPRAEDSLQILQEIAAGAKAEGKIIDQNCWLIPDRRTAIEQALATAQAGDVVLLLG
KGHEGNIIYASGDIEWNEHAEAERALQGLGYIKR
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgttcgctgaacttttgctgcatgttacccatcaagcttctggcgatcaccac
gttgcaattagcaatgtagcttacgattcgcgcaaagttacacctggagcgctgtttgtg
gcgatcaaaggggtacatgttgatggtcatcgttatattgcaacggccttggagcaaggc
gcggtggcagtggtctatgatgatcctcatcaagcgccgcctgccactattccctcggct
ttggttgccgatgccaaggttgcgctttcgccgattgccgccgccttttacgattacccc
gcccagcaattagaagtggtaggcattaccggctcaaagggcaaaaccaccaccaccttt
ttaaccgcagccgccctagaagctagcggcgagttggtgggctttatgagcactgtcgat
tttaaaattggccagcgccaatgggccaacaaaacccgccaatcgacccccgaagccttg
gaaattcaggccatgttgcgcgagatggtcgaggctggttgtcgctatgctgtggtcgaa
agcacgtcgcatggcctctcgccccgttggaatcggctgggcgattgtgcctatgatgtg
gccttgattaccaacgttacccacgaacaccttgattatcatggcaccgttgagcaatat
cgtgctgataaagctcaattatttcagttgctcgccactagccccagccaaaaatcgatt
cttggccaaccaacgccagtcgaaaaagtcgcaatcgttaatgccgatgatccccatgcg
gcccaatttcgggcagcggctggcgagcaagtgcggcatttgagctatgcaattcatgct
gaggctgatcttcgggctaccgaaattgtctcaactagcaagggcttgcggtttaccgca
attacgccgcaaggtaactttgcgctcaatttgcaattggttggcacattttatgtttac
aacgtgttagcagcgctcagtgtctgtttggcgcgaggcgttgatctggcggcggcgatt
cagcggcttgaggcaattccaggcatcaacggtcgcatggagcaagttgagcttggccag
ccatttagtgtgctagtcgattatgcccataaccccgattcgtttgagcaagtgatgagt
atgctgcggccattgacccaaggccgtttgattgcggtatttggttcagcaggcgagcgc
gatcttgccaagcgcccgattcaaggccaaattgcggccaaatggtgcgatctgctctat
ctgaccgatgaagatccccgagccgaggattcgctacagattttgcaggaaattgctgct
ggcgcaaaggctgagggcaaaattatcgatcaaaattgctggctgattcccgatcggcga
acggccatcgagcaagcgctggcaaccgcccaagctggcgatgtggtgctgttgctaggc
aaaggccacgaaggcaacatcatttatgccagcggcgatatcgaatggaacgagcatgcc
gaggctgaacgcgcattgcaaggcttgggctacatcaaacgataa

DBGET integrated database retrieval system