KEGG   Herpetosiphon aurantiacus: Haur_3638Help
Entry
Haur_3638         CDS       T00614                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Haur_3638
Enzymes [BR:hau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Haur_3638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4575362..4577296)
Genome map
AA seq 644 aa AA seqDB search
MPLGVCYYPEHWPQTWWADDAKQMQALGLEYVRIGEFAWALMEPAAGQYDWVWLDQAIET
LASQGLNIVLGTPTATPPAWLTHNQPDLMRIDAQGRRLGHGGRRQACLVNPQYIEYSRQI
VTAMAERYGQHPAVAAWQIDNEIGNHGSARCYCEHCAAAFRQWLIQRYGDLAGLNEAWGT
AFWSQTYSDWQQIPLPNVPVGGGHNPSLVLDYRRFASDQQVAYCAMQAEILRQHSPNRTI
LTNIAPGDDEINWFDMAQQVDTIAWDNYPHGFPDWQAVAMYHDHIRGLKRQPFWVMEQQP
GQINWTPTNPPVPPNQVRLWSYQDAAHGAANVLYFRWRACWLGQEQYHSGLRDHANRPAR
GSTEARIVANEWQQHGQPEAAPRKVALLVSYDDHWAQQLDPHAQGWNYWQLLRTIHRTLT
SYGVGVDIVQRGTPLAAYQLAIAVAPMLDNPAETAGWREWVQAGGTLICTPRSLTKRRDN
RTAPDGFPSGLTDLFGADVAEWSALDPAKPWAVKFGETSHTAPLWMEVLNVSHANSLATW
SKSYAKGQAAITAATYGKGLAVLMGCYPTEEILGDLLPRLWPAAQRLPNEIERIELTDGV
LWFNHGEQAQSVKLQGTWHDRLSGEQCSGDCSIESLGIRWLKPL
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgccattaggtgtttgttattaccccgagcattggccccaaacgtggtgggccgatgat
gccaaacagatgcaggccttgggcttggaatatgtgcggattggcgagtttgcttgggct
ttgatggagccagccgctggccagtatgattgggtatggctcgaccaagcaattgaaacc
ttggcgagccaaggcttgaacattgtgcttggcacgcccaccgctaccccgcctgcttgg
ctaacgcataaccagcccgatttaatgcggatcgatgcccaaggccgtcgtttaggccat
ggtggtcgtcgccaagcttgtttggtcaatcctcagtacatcgaatatagccgccagatc
gtcacggccatggccgagcgctatggtcagcatccagcggttgccgcttggcaaatcgat
aacgaaattggcaatcatggctcggcgcgttgctactgcgaacattgtgctgcggctttt
cgccaatggctgatccaacgctatggcgatttagcaggcctcaacgaagcatggggcacg
gccttttggagccaaacctacagcgattggcaacaaattcccttgccaaatgtaccagtt
ggcggcggccataatccctcgttagtgctcgattatcgccgcttcgcctcggatcagcag
gtagcatattgcgcgatgcaggcagaaattttgcgccagcactctccaaatcgcacgatt
ttaaccaacatcgcacctggcgacgatgagattaattggtttgatatggcgcagcaagtc
gatacaattgcttgggataattacccgcatggctttcccgattggcaagcggtggcgatg
tatcacgaccatattcgtggcctcaagcgtcagccattttgggtgatggagcaacagcca
ggccaaatcaattggactcccaccaatccaccagtgccacccaaccaagtgcgcttgtgg
agctatcaagatgccgcccatggtgcagccaatgtgctgtatttccgctggcgggcatgt
tggctcggccaagagcaatatcatagcggcctgcgcgatcatgccaatcggccagcgcgt
ggcagcaccgaagcgcggattgttgccaacgaatggcagcagcatggccagcccgaagct
gcaccgcgcaaggttgccttgctggtttcctacgacgatcattgggcgcaacaactcgat
ccgcatgctcaaggctggaattattggcaattgctgcgcaccatccatcgcacgcttacc
agctatggcgttggggtcgatattgtgcagcgtggcacgccactcgctgcctatcaacta
gcgattgctgtcgccccaatgctcgataatcctgctgaaactgcgggctggcgtgagtgg
gttcaggcaggcggcacgttgatctgcacgccacgcagtttaaccaaacgccgcgacaat
cgcaccgctcccgatggcttccccagcggcttgaccgatttatttggggctgatgttgcc
gagtggagcgccctcgacccagccaagccgtgggcagtcaaatttggcgagacgagccac
accgcaccactttggatggaagtgctgaatgtgagccatgccaatagcttagcaacctgg
agcaaaagctacgcaaagggtcaggctgcaatcaccgccgcgacctatggcaaaggccta
gcagtattgatgggctgctatcccaccgaggaaattttgggcgatctgctgccacggctc
tggcccgctgcccaacgcttgcccaacgaaattgaacgcatcgagttgaccgatggcgtg
ttgtggttcaaccatggcgaacaagcccaaagcgtcaaacttcaaggcacttggcacgat
cgcttgagtggcgagcaatgcagtggcgattgttcaatcgaaagtttaggtattcgctgg
ctcaaacccctataa

DBGET integrated database retrieval system