KEGG   Herpetosiphon aurantiacus: Haur_4636Help
Entry
Haur_4636         CDS       T00614                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00010  Glycolysis / Gluconeogenesis
hau00020  Citrate cycle (TCA cycle)
hau00620  Pyruvate metabolism
hau01100  Metabolic pathways
hau01110  Biosynthesis of secondary metabolites
hau01120  Microbial metabolism in diverse environments
hau01130  Biosynthesis of antibiotics
hau01200  Carbon metabolism
Module
hau_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Haur_4636
   00020 Citrate cycle (TCA cycle)
    Haur_4636
   00620 Pyruvate metabolism
    Haur_4636
Enzymes [BR:hau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Haur_4636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N PYNP_C GCV_H
Motif
Other DBs
NCBI-ProteinID: ABX07267
JGI: Haur4636
UniProt: A9B180
Position
5924475..5925803
Genome map
AA seq 442 aa AA seqDB search
MAKKLEMPKMGYDMVEGTLAKWLKKPGDEVSRGEPIAEVETDKVTIEIEAFEAGTILKFL
VNEGETVPVGAPIAEIDDGSGDDEAEAANASVTPSSDAPAVGEGGEAAPPAPAVVAQPEK
VEATPAASAPATSTGRLFATPAARGLAEQRGVDLAGLKGSGPDGRIVKADVLAAAVAPKA
APAATPAAAPAAAQAAPVASPVPAPVGLIFAPPAPNSVYTEEPLSRLRQTAAKRMVESQQ
QVPPFFVTSTIEMDAIQALLPKLREAHGGKLSVTELLLKACAIALKKFPALNSTFAGDKL
LVHKDVHISVAVATDAGLLAPVVRNCDSLSLGAISNQMRDVIGRTRDGKAGLDDLQGGTF
TVSNLGMFDVTNFIAIITPPQSAILAVGSTIATPVVRDGEIVIRQLMNVTVSADHRATDG
ASVAQFLVELKNLLQNPFKLLL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaactagaaatgcccaaaatgggctacgatatggtcgaaggtactttggcc
aaatggttgaaaaagccaggcgatgaggtttcgcgtggtgaaccaattgctgaagtcgaa
accgataaggtcacgattgaaatcgaggcttttgaggctgggacaatcttaaagttcttg
gtcaacgaaggcgaaaccgtgccagttggtgcgccaatcgccgaaattgacgatggctca
ggcgatgacgaggccgaagcagccaatgccagcgttacgccttccagcgatgctccagca
gttggcgagggtggcgaggccgctccgccggctcctgccgtggtcgctcaaccagaaaaa
gttgaggctacaccagcagccagtgctccggcaaccagcactgggcgcttgtttgcaact
ccagctgctcgcggtttggccgaacaacgcggcgtagatttggctggcctcaagggttct
ggccctgatggccgaattgttaaggccgatgtattggctgctgccgttgcaccaaaggct
gcacctgctgctaccccagccgctgcgccagctgctgcacaagcggctccagttgcatca
ccagtgccagcaccagttggcttgatcttcgcgccaccagcaccaaattcggtctacacc
gaggagccactctcgcgcttacgccaaaccgctgccaagcgcatggtcgaaagccaacaa
caagtgccaccattcttcgttacttcaacgattgaaatggatgcgattcaagccttgttg
cctaagttgcgtgaagctcatggtggcaaactttcagtgactgaattgttgctgaaggct
tgtgctatcgccttgaagaagttccccgcactcaactcgaccttcgctggcgataagttg
ttggttcacaaagatgttcacatcagcgtggctgtagcaaccgatgctggcttgttggct
ccagtcgtgcgcaactgcgatagcttgagcctcggcgcaatctccaaccaaatgcgcgat
gtgattggccgcacccgcgatggcaaagctggcctcgacgatctccaaggcggcacgttt
accgtcagcaacttggggatgttcgatgtcaccaacttcatcgcgattatcacgccaccc
caaagcgcaattttggcagttggcagcacaattgccactccagttgtccgcgatggtgaa
attgtgattcgtcaattgatgaatgtcacggtttcagctgaccaccgcgccactgatgga
gcaagcgttgcccagttcttggttgaactcaagaacttgctgcaaaacccattcaagctc
ttgctctaa

DBGET integrated database retrieval system