KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_3076Help
Entry
Hden_3076         CDS       T01265                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3143645..3144760)
Genome map
AA seq 371 aa AA seqDB search
MGTITSRQFPFSAVIMITSLVAVASAYFLWTLWMRSDFGLTTWAEWSDISWQVAEVDSRG
RIIRLGSHPMAIAALAGTISVCFVAFMFGAWQFLTGNEIRRKKDNDAASNRIEKVGQELD
DEVLVLLGLLRQHTDVSSLHSEVLAKVNKTLPSLTTPDQVRGVVQRLIAENTKIRSEVDV
LNARLQQSQTQIEKLRSSLSESQYLGMLDAVTQLKNRHWLEANLPREVKAASELNEPLCL
IMADVDHFKKINDTFGHTVGDEILRRFGELLSKNIKGRDTAVRYGGEEFVVLLPQTQIEG
ADNLGEQIRDELQRKKWMHHRTGKPIGTVTASFGIAELRPGDGPESLLERADAKLYEAKA
DGRNCVKSDSD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgataacttcaaggcagtttccattttcggccgtgatcatgattacgagcctc
gttgctgtagcctctgcttacttcctatggactttgtggatgcggagcgacttcggtctt
acaacctgggcggagtggtccgacatcagctggcaggttgcggaggtcgattctcgcggc
cgcatcattcgcctcggatcgcacccgatggccattgcggcattggccggaaccatttcg
gtttgcttcgtcgcattcatgtttggcgcttggcagtttttaaccggcaacgaaatccgc
cgcaaaaaggataacgacgccgcgtcaaaccgtatcgaaaaagttggtcaggaactggat
gacgaggtgttggtgctgttgggcctgttgcgccagcataccgatgtcagcagcctgcat
tccgaagttctggcaaaggtcaacaagacgcttccatcgctgacgacgccggatcaggtg
agaggtgttgtgcagcgcctgatcgccgaaaacacgaagattcgcagcgaagtcgacgtc
ttgaacgcgcgcttgcagcaatcgcaaacacagatcgaaaagctacgatccagcctgagc
gagagtcagtatctcggtatgctcgatgccgtgacgcaactcaaaaaccgccactggctc
gaagccaacctgccccgcgaggtgaaggcggcgtcggaactcaacgagcccctttgcctt
atcatggccgacgtggatcacttcaagaaaatcaacgatacgtttggccataccgtgggc
gacgaaattctcaggcggttcggtgaacttctgtcgaagaatatcaagggccgcgataca
gctgtccgctacggcggagaagaatttgtcgtcctgctgccgcaaactcagatcgagggc
gcggataatcttggcgaacaaattcgcgacgaactgcaacgcaagaaatggatgcaccat
cggaccggcaagccgatcggtacggttacggcatccttcggcatcgccgagcttcgtccc
ggagacggccccgagtccctactcgagcgtgccgacgcgaaactctacgaagcaaaagcg
gatggccgcaattgcgtgaaatcggacagcgattaa

DBGET integrated database retrieval system