KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_3076Help
Entry
Hden_3076         CDS       T01265                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Brite
Enzymes [BR:hdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Hden_3076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3143645..3144760)
Genome map
AA seq 371 aa AA seqDB search
MGTITSRQFPFSAVIMITSLVAVASAYFLWTLWMRSDFGLTTWAEWSDISWQVAEVDSRG
RIIRLGSHPMAIAALAGTISVCFVAFMFGAWQFLTGNEIRRKKDNDAASNRIEKVGQELD
DEVLVLLGLLRQHTDVSSLHSEVLAKVNKTLPSLTTPDQVRGVVQRLIAENTKIRSEVDV
LNARLQQSQTQIEKLRSSLSESQYLGMLDAVTQLKNRHWLEANLPREVKAASELNEPLCL
IMADVDHFKKINDTFGHTVGDEILRRFGELLSKNIKGRDTAVRYGGEEFVVLLPQTQIEG
ADNLGEQIRDELQRKKWMHHRTGKPIGTVTASFGIAELRPGDGPESLLERADAKLYEAKA
DGRNCVKSDSD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgataacttcaaggcagtttccattttcggccgtgatcatgattacgagcctc
gttgctgtagcctctgcttacttcctatggactttgtggatgcggagcgacttcggtctt
acaacctgggcggagtggtccgacatcagctggcaggttgcggaggtcgattctcgcggc
cgcatcattcgcctcggatcgcacccgatggccattgcggcattggccggaaccatttcg
gtttgcttcgtcgcattcatgtttggcgcttggcagtttttaaccggcaacgaaatccgc
cgcaaaaaggataacgacgccgcgtcaaaccgtatcgaaaaagttggtcaggaactggat
gacgaggtgttggtgctgttgggcctgttgcgccagcataccgatgtcagcagcctgcat
tccgaagttctggcaaaggtcaacaagacgcttccatcgctgacgacgccggatcaggtg
agaggtgttgtgcagcgcctgatcgccgaaaacacgaagattcgcagcgaagtcgacgtc
ttgaacgcgcgcttgcagcaatcgcaaacacagatcgaaaagctacgatccagcctgagc
gagagtcagtatctcggtatgctcgatgccgtgacgcaactcaaaaaccgccactggctc
gaagccaacctgccccgcgaggtgaaggcggcgtcggaactcaacgagcccctttgcctt
atcatggccgacgtggatcacttcaagaaaatcaacgatacgtttggccataccgtgggc
gacgaaattctcaggcggttcggtgaacttctgtcgaagaatatcaagggccgcgataca
gctgtccgctacggcggagaagaatttgtcgtcctgctgccgcaaactcagatcgagggc
gcggataatcttggcgaacaaattcgcgacgaactgcaacgcaagaaatggatgcaccat
cggaccggcaagccgatcggtacggttacggcatccttcggcatcgccgagcttcgtccc
ggagacggccccgagtccctactcgagcgtgccgacgcgaaactctacgaagcaaaagcg
gatggccgcaattgcgtgaaatcggacagcgattaa

DBGET integrated database retrieval system