KEGG   Helicobacter pylori F57: HPF57_1358Help
Entry
HPF57_1358        CDS       T01912                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hex  Helicobacter pylori F57
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hex00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1436227..1437033
Genome map
AA seq 268 aa AA seqDB search
MMHAFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKLKDIISVKSALSFSLKGDFDCPL
EENSLFKALQILKNFLKSKNFSNSTIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHL
NQIFDWRLSLEELYRMGSLVGADTNFFISQHKSANATSYGEVIENFEEEPLENRLEIYAP
NHVFCSTKAIYQAYKPETCFSQAKEWLKKPSLECLKTYDRNELNDLLKPALLANQALRDI
ESELGKEWFFSGSGSTFFRLKPALKGGE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcatgcttttgaggtttatcctaaagtcaatatttttttaaaaatccttcacaaa
gaaggggcttaccataagctcatttctcgcatgtgtttggtcaaagataagctaaaggat
attattagcgtcaaaagcgcgctttccttttcactaaaaggggattttgactgcccttta
gaagaaaactcgctctttaaagccctccaaattttaaaaaattttttaaaatcaaaaaat
ttctctaattccacaatcaaatccctagacaccctagcgattgaagtggaaaaaaacatc
cccactcaagccgggttaggcggtgggagcgctgatgctggggggctattgtatcatttg
aatcaaatttttgactggcgtttgagtttagaagagctttatcgcatgggatctttagtg
ggcgcagacaccaattttttcatctcgcaacacaaaagcgctaacgctacttcttatggc
gaagttattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatgcgcca
aaccatgttttttgcagcaccaaagccatctatcaagcttataagcctgaaacttgtttt
tctcaagctaaagagtggcttaaaaagccgagtttagaatgcctaaagacttatgataga
aacgaattaaacgatcttttaaaaccggctttactcgctaaccaagccttaagagatata
gaaagcgaattaggcaaggagtggttttttagcgggagtgggagcacgttttttaggcta
aagcctgcgttaaaagggggtgaatga

DBGET integrated database retrieval system