KEGG   Helicobacter pylori F57: HPF57_1358Help
Entry
HPF57_1358        CDS       T01912                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hex  Helicobacter pylori F57
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hex00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPF57_1358
Enzymes [BR:hex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HPF57_1358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1436227..1437033
Genome map
AA seq 268 aa AA seqDB search
MMHAFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKLKDIISVKSALSFSLKGDFDCPL
EENSLFKALQILKNFLKSKNFSNSTIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHL
NQIFDWRLSLEELYRMGSLVGADTNFFISQHKSANATSYGEVIENFEEEPLENRLEIYAP
NHVFCSTKAIYQAYKPETCFSQAKEWLKKPSLECLKTYDRNELNDLLKPALLANQALRDI
ESELGKEWFFSGSGSTFFRLKPALKGGE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcatgcttttgaggtttatcctaaagtcaatatttttttaaaaatccttcacaaa
gaaggggcttaccataagctcatttctcgcatgtgtttggtcaaagataagctaaaggat
attattagcgtcaaaagcgcgctttccttttcactaaaaggggattttgactgcccttta
gaagaaaactcgctctttaaagccctccaaattttaaaaaattttttaaaatcaaaaaat
ttctctaattccacaatcaaatccctagacaccctagcgattgaagtggaaaaaaacatc
cccactcaagccgggttaggcggtgggagcgctgatgctggggggctattgtatcatttg
aatcaaatttttgactggcgtttgagtttagaagagctttatcgcatgggatctttagtg
ggcgcagacaccaattttttcatctcgcaacacaaaagcgctaacgctacttcttatggc
gaagttattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatgcgcca
aaccatgttttttgcagcaccaaagccatctatcaagcttataagcctgaaacttgtttt
tctcaagctaaagagtggcttaaaaagccgagtttagaatgcctaaagacttatgataga
aacgaattaaacgatcttttaaaaccggctttactcgctaaccaagccttaagagatata
gaaagcgaattaggcaaggagtggttttttagcgggagtgggagcacgttttttaggcta
aagcctgcgttaaaagggggtgaatga

DBGET integrated database retrieval system