KEGG   Haliscomenobacter hydrossis: Halhy_1420Help
Entry
Halhy_1420        CDS       T01491                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
hhy  Haliscomenobacter hydrossis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1780433..1781503
Genome map
AA seq 356 aa AA seqDB search
MKNKHLLILLLALMGSTTFAQTTKGLKDYYKKYFPIGVAVAPRMMDDAAESGLILAQFNS
MTPENAMKMGPIHPEENRYNWAPADKIADFAVQHGLKMRGHTLCWHSQTPNWLFKDSNGA
TVSKEVLLARLKQHIFDVVGRYKGKIYVWDVVNEAVPDGGTDIYRKSPFYEIIGPEYIEK
AFQYAHEADPKALLFYNDYNTENASKRDRIYQLVKGLKDKGVPIHGVGLQGHWALTEPTA
EELKTSIKKFASLGLQVQVTELDVSVHPKEHERRTEVFTGKVEYTAEMEAKQVAQYKMLF
EVLRKHRKAVTSVTFWNLSDKSTWLDNFPVRGRKDYPLLFDGNYQPKKAFFAVTKW
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaagcatctgcttatattgctactggccttaatgggcagtaccacttttgcc
caaacgaccaaagggctcaaagattattacaaaaaatacttccccatcggagtagccgtt
gccccccgtatgatggacgacgccgctgaatctggccttattctggcgcaattcaacagc
atgacgcctgaaaatgccatgaaaatggggcccatccaccccgaagaaaatcgctacaac
tgggcacctgccgataaaatcgccgattttgcagtgcagcatggccttaaaatgcgggga
cataccctgtgctggcacagccaaacgccgaattggttgttcaaggattccaacggggca
acggtcagtaaggaagtacttctggctcgtttgaagcaacacattttcgacgtagttggc
cgctacaagggcaaaatttacgtctgggacgtggtgaatgaagccgtgccagatggtggc
acggacatctaccgcaaatcacctttttacgagatcatcggtccggaatacattgaaaaa
gcgtttcaatacgcccacgaggccgaccccaaagcgctattgttttacaatgattacaat
accgaaaatgcctccaaacgcgatcgcatttaccaattggtaaaaggcttgaaagacaaa
ggggtaccgattcacggggtaggcctgcaggggcattgggcgctcacggaaccgactgcg
gaggaactcaaaacttcgatcaaaaaattcgccagcctaggtttgcaggtacaggttacg
gagttggacgtatcggttcatcccaaagagcacgagcgcagaacagaagtcttcacgggt
aaggtggaatataccgcggagatggaagccaaacaggttgcgcagtataaaatgctcttt
gaagttttgcgcaaacaccgcaaagctgtgacgagtgtgactttttggaatttgtcggac
aagtcgacctggttggacaatttcccggtgcggggaagaaaggattatccgctgcttttt
gatgggaattatcagccgaagaaggcgttttttgcagtgacgaagtggtaa

DBGET integrated database retrieval system